Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1722 bp · TkA03G563890|TK1151|cDNA
AAATAATGCATCAATACAGTTTTCACAAACAAAAATAAAATAAACACCTAAATCTTCAAAGCAATGACTCTAATTCTAGCTCTCATAATCATCATCTCAACTCTATTTCTCCTTCGATCTCTCCTCGCATTTCTCAACAACACATGGTGGACTCCAATTAGCATCCAGAAAATCATGAAATCGCAAGGAATCAAAGGCCTCCCATATTCATTTCCTCACGGAAACACCAAAGTCATCACTGCCATGAGAAACCAATCCAT...
1533 bp · TkA03G563890|TK1151|CDS
ATGACTCTAATTCTAGCTCTCATAATCATCATCTCAACTCTATTTCTCCTTCGATCTCTCCTCGCATTTCTCAACAACACATGGTGGACTCCAATTAGCATCCAGAAAATCATGAAATCGCAAGGAATCAAAGGCCTCCCATATTCATTTCCTCACGGAAACACCAAAGTCATCACTGCCATGAGAAACCAATCCATGAGCCAGCCAATGGATATATCACACGACATATTTCCAAGAATTCAGCCACATGTCTATTCTTG...
Protein
Download Protein FASTA510 aa · TkA03G563890|TK1151|PROTEIN
MTLILALIIIISTLFLLRSLLAFLNNTWWTPISIQKIMKSQGIKGLPYSFPHGNTKVITAMRNQSMSQPMDISHDIFPRIQPHVYSWIKTYGMNFVNWHGSQAQMFVTEPELVKEVLNNREGAYPKMDMEGYAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKNMIPEMIGSMEKMVEKWKEYEGEEIDIHKEFGLVTTEVISRTAFSSSYVEGKHIFEMVAKLTTITVRNIYKLRFPGISLIMKTNDEIEAEKLEK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G563890 |
|---|---|
| TK1151 ID | TkA03G563890 |
| OH-1004 ID | LXL04_011066 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G563890 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:143081160-143083233 (-) | |||||||||
| Description | Similar to Cytochrome P450 CYP749A22 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006694 steroid biosynthetic process Biological Process GO:0008203 cholesterol metabolic process Biological Process GO:0009741 response to brassinosteroid Biological Process GO:0010268 brassinosteroid homeostasis Biological Process GO:0016131 brassinosteroid metabolic process Biological Process GO:0016135 saponin biosynthetic process Biological Process GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0004497 monooxygenase activity Molecular Function GO:0005506 iron ion binding Molecular Function GO:0008395 steroid hydroxylase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ag:ABC59075 ath:AT2G26710 ath:AT3G14690 mtr:25486186 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00067p45089-503 aaPF26162YwzD299-314 aaPF06970RepA_N466-507 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G563890 | PF00067 | p450 | 89 | 503 | 7.9e-76 | 256.4 |
| TkA03G563890 | PF26162 | YwzD | 299 | 314 | 0.047 | 13.7 |
| TkA03G563890 | PF06970 | RepA_N | 466 | 507 | 0.098 | 13.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.