TkA03G561830 | RubberDandelionOmics

Gene overview

TkA03G561830

Reference: TK1151 Chr: Chr03 Coordinates: 142601057-142610850 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6066 bp · TkA03G561830|TK1151|cDNA

GCAAAAGCAGAATCACTACAAAACACAACAGCAATCAATCTCTCAAAAAGTTGAAATGCAAATTCAAAAGATCCCGATATATATCGACTTCATACGTAAGTACAAAAATGAATCTCAATTATACTCTCTTCAGCAGAACACATGCTTCCATTCCGGTGTACAACAGATTCAATCGTGTATTAGTGCTGATTCTGGAGCTGGTTGGATATGGCGAGCTCGAGTGGGACGAAGGATGTAGGGCCGCCGAGGTCGCTGTCAAG...

CDS

Download CDS FASTA

5694 bp · TkA03G561830|TK1151|CDS

ATGGCGAGCTCGAGTGGGACGAAGGATGTAGGGCCGCCGAGGTCGCTGTCAAGGAGGAGTTTCGCCATGGTTGATCCATATGCTGATGACAACGCTAGCGTTGACAGTGAGCTCGTGCCGTCTTCACTTGCTTCTATTGCTCCAATTCTTCGTGCTGCAAATGAAACCGAGAAGGCTAACCCTAGAGTTGCTTACCTGTGCCGGTTTCATGCATTTGAGAAGGCACACAGGATGGATCCTAAATCTACAGGACGTGGTGT...

Protein

Download Protein FASTA

1897 aa · TkA03G561830|TK1151|PROTEIN

MASSSGTKDVGPPRSLSRRSFAMVDPYADDNASVDSELVPSSLASIAPILRAANETEKANPRVAYLCRFHAFEKAHRMDPKSTGRGVRQFKTYLLHRLQKEELEAKFRLAKTDPKEIQKYYQNFYEKNIRDGQNTKKPEEMAKIYQIASVLYDVLRTVVVPFTKVEDETQGYAKDVEEKKEPYEPYNNNIFPLYAPELPEIKAALRALRNVDNLPLLRKPGDRDKSIKDILEWLSLVFGFQKGNVANQREHLVLLLANID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G561830`
TK1151 ID	TkA03G561830
OH-1004 ID	LXL04_011045
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 98.208 / OH-1004 94.473 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G561830

Location Chr03:142601057-142610850 (-)

Description Similar to CALS7: Callose synthase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06490`	Involved in callose synthesis at the forming cell plate during cytokinesis.	No verified direct reference in this release
`At3g59100`	Probably involved in callose synthesis, but not required for callose formation after wounding or pathogen attack.	An Arabidopsis Callose Synthase, GSL5, Is Required for Wound and Papillary Callose Formation.2003 · DOI: 10.1105/tpc.016097
`At1g05570`	Involved in callose synthesis at the forming cell plate during cytokinesis.	An Arabidopsis Callose Synthase, GSL5, Is Required for Wound and Papillary Callose Formation.2003 · DOI: 10.1105/tpc.016097
`At5g13000`	Involved in callose synthesis at the forming cell plate during cytokinesis.	No verified direct reference in this release
`At2g31960`	Involved in callose synthesis at the forming cell plate during cytokinesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011045 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006075 (1->3)-beta-D-glucan biosynthetic process Biological Process

GO:0008360 regulation of cell shape Biological Process

GO:0010233 phloem transport Biological Process

GO:0071555 cell wall organization Biological Process

GO:0080165 callose deposition in phloem sieve plate Biological Process

GO:0000148 1,3-beta-D-glucan synthase complex Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009504 cell plate Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003843 1,3-beta-D-glucan synthase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05570

ath:AT1G06490

ath:AT2G31960

ath:AT3G59100

ath:AT5G13000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.610

Rank 1 · TkA03G561830 · TK1151

Endoplasmic reticulum0.187

Rank 2 · TkA03G561830 · TK1151

Cytoplasm0.100

Rank 3 · TkA03G561830 · TK1151

Golgi apparatus0.100

Rank 4 · TkA03G561830 · TK1151

Lysosome / Vacuole0.095

Rank 5 · TkA03G561830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04652Vta145-173 aa

PF25968CALS1140-168 aa

PF14288FKS1_dom1149-169 aa

PF14288FKS1_dom1313-424 aa

PF25968CALS1832-1014 aa

PF02364Glucan_synthase1021-1101 aa

PF02364Glucan_synthase1109-1709 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G561830	`PF04652`	Vta1	45	173	1.2e-12	48.8
TkA03G561830	`PF25968`	CALS1	140	168	2.1e-64	217.2
TkA03G561830	`PF14288`	FKS1_dom1	149	169	1.1e-42	145.5
TkA03G561830	`PF14288`	FKS1_dom1	313	424	1.1e-42	145.5
TkA03G561830	`PF25968`	CALS1	832	1014	2.1e-64	217.2
TkA03G561830	`PF02364`	Glucan_synthase	1021	1101	3.3e-232	773.9
TkA03G561830	`PF02364`	Glucan_synthase	1109	1709	3.3e-232	773.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHJ3`	Arabidopsis thaliana	sp\|Q9SHJ3\|CALS7_ARATH Callose synthase 7	70.800%	Swiss-Prot	High
`Q9LYS6`	Arabidopsis thaliana	sp\|Q9LYS6\|CALS6_ARATH Putative callose synthase 6	69.600%	Swiss-Prot	High
`Q9AUE0`	Arabidopsis thaliana	sp\|Q9AUE0\|CALS1_ARATH Callose synthase 1	55.700%	Swiss-Prot	High
`Q9LXT9`	Arabidopsis thaliana	sp\|Q9LXT9\|CALS3_ARATH Callose synthase 3	55.200%	Swiss-Prot	High
`Q9SL03`	Arabidopsis thaliana	sp\|Q9SL03\|CALS2_ARATH Callose synthase 2	55.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card