TkA03G560970 | RubberDandelionOmics

Gene overview

TkA03G560970

Reference: TK1151 Chr: Chr03 Coordinates: 142273309-142275894 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2275 bp · TkA03G560970|TK1151|cDNA

TTATTCTTTAACGATTTAAAAAAATTCAATTTGTCACACCAAATTTATTGGGTTTCCCTACTTTCTGGTAGCCATGGAATCAAAAGTCGGCCGCCATTCTAACCCAACAGTTCATCGTCAACAAACATTTTCTTCGGTCCAAATGGCTACACTTCCTCGTATCTTCCTCCACTTCTACTCTTCTTGAAAACCTACATCACACATTCTTTGCAAGATTTTAAAAGTTTGGTTGGTTATTTGTAGGATTCACTCGATCTTAT...

CDS

Download CDS FASTA

1086 bp · TkA03G560970|TK1151|CDS

ATGAAAGGGAAGTTTGGGGCATCAGGGACTTATTTCCTGTTGAATACAGGCGCCAAGATTCCGGCCATAGGGCTCGGAACTTGGCAGAGCGGCGGCGACTTTTGTGTAGAGGCAGTAAAAACAGCTCTATCAGTCGGCTACCGCCACATCGATTGTGCACACCTGTACGGAAACGAGGCTGAAGTCGGTGAAGCGTTAACCGAATTTTTCAAGGGTTCTTCAAAAAGAGAGGATCTTTTTCTAACCTCCAAGCTATATTG...

Protein

Download Protein FASTA

361 aa · TkA03G560970|TK1151|PROTEIN

MKGKFGASGTYFLLNTGAKIPAIGLGTWQSGGDFCVEAVKTALSVGYRHIDCAHLYGNEAEVGEALTEFFKGSSKREDLFLTSKLYCTMNSTNKIENSVKVSLKNLGVSYLDLYLMHWPESSAFGDATDPPASSGSEYRQFLSKLKTAWKTMEKLVDLGLVRAIGVSNFNIQQMKELLKFAKITPAVNQVELHPFWRQDELVKFCQSKHIHVSAHTPLGVPTSAPKPSESGSSEEDEPGTPRISFRRSRSVHGPMLKLSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G560970`
TK1151 ID	TkA03G560970
OH-1004 ID	LXL04_011021
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G560970

Location Chr03:142273309-142275894 (+)

Description Similar to AKR4C9: NADPH-dependent aldo-keto reductase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37790`	Oxidoreductase that may act on a broad range of substrates such as ketosteroids, aldehydes, ketones and sugars.	No verified direct reference in this release
`At2g37770`	Oxidoreductase acting on a broad range of substrates: reduces ketosteroids, aromatic aldehydes, ketones, sugars and other aliphatic aldehydes, and oxidizes hydroxysteroids.	Characterization of two novel aldo-keto reductases from Arabidopsis: expression patterns, broad substrate specificity, and an open active-site structure suggest a role in toxicant metabolism following stress.2009 · DOI: 10.1016/j.jmb.2009.07.023 NADPH-dependent reductases involved in the detoxification of reactive carbonyls in plants.2011 · DOI: 10.1074/jbc.m110.202226
`At3g53880`	Oxidoreductase that may act on a broad range of substrates such as ketosteroids, aldehydes, ketones and sugars.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011021 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009636 response to toxic substance Biological Process

GO:0009651 response to salt stress Biological Process

GO:0019640 D-glucuronate catabolic process to D-xylulose 5-phosphate Biological Process

GO:0019853 L-ascorbic acid biosynthetic process Biological Process

GO:0042593 glucose homeostasis Biological Process

GO:0042840 D-glucuronate catabolic process Biological Process

GO:0044597 daunorubicin metabolic process Biological Process

GO:0044598 doxorubicin metabolic process Biological Process

GO:0046185 aldehyde catabolic process Biological Process

KEGG gene cross-reference

ath:AT2G37770

ath:AT2G37790

bta:618607

dre:445326

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.559

Rank 1 · TkA03G560970 · TK1151

Nucleus0.300

Rank 2 · TkA03G560970 · TK1151

Plastid0.097

Rank 3 · TkA03G560970 · TK1151

Cell membrane0.084

Rank 4 · TkA03G560970 · TK1151

Mitochondrion0.078

Rank 5 · TkA03G560970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00248Aldo_ket_red22-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G560970	`PF00248`	Aldo_ket_red	22	319	1.9e-58	198.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84TF0`	Arabidopsis thaliana	sp\|Q84TF0\|AKRCA_ARATH Aldo-keto reductase family 4 member C10	42.800%	Swiss-Prot	Medium
`Q0PGJ6`	Arabidopsis thaliana	sp\|Q0PGJ6\|AKRC9_ARATH NADPH-dependent aldo-keto reductase, chloroplastic	43.100%	Swiss-Prot	Medium
`Q9M338`	Arabidopsis thaliana	sp\|Q9M338\|AKRCB_ARATH Aldo-keto reductase family 4 member C11	40.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card