TkA03G560900 | RubberDandelionOmics

Gene overview

TkA03G560900

Reference: TK1151 Chr: Chr03 Coordinates: 142252856-142254666 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

954 bp · TkA03G560900|TK1151|cDNA

CACAACACCGGGTCGTCAATACCTCACTTCTTCTCCAAGCCACTTCCTTCGACATAAACTCCCCCAATTCATATCAAAACTTCCTATAATTTCTCAATTCGGAGAAAAAGGCTGAGAGGGATCGATCAACACACAGAAAGACAAAGATGGAATGTGTTTTTGGTATGGTGGGAAAAGGTTTTGCCTTGGTGGTAGCAGATACATCGGCCGTTAACAGTATTCTAGTTCACAAATCGAACGAGGACAAGATCATGGTTCTC...

CDS

Download CDS FASTA

597 bp · TkA03G560900|TK1151|CDS

ATGGAATGTGTTTTTGGTATGGTGGGAAAAGGTTTTGCCTTGGTGGTAGCAGATACATCGGCCGTTAACAGTATTCTAGTTCACAAATCGAACGAGGACAAGATCATGGTTCTCGATTCTCACAAGCTCATGGGCGCCAGTGGTGAAGCTGGTGATCGAGCTCAATTCACGGAGTATGTACAGAAAAATGTATCTCTGTATCAATTCAGAAATGGGATTCCACTGACTACCAAGGCTGCTGCAAATTTCATGCGTGGTGA...

Protein

Download Protein FASTA

198 aa · TkA03G560900|TK1151|PROTEIN

MECVFGMVGKGFALVVADTSAVNSILVHKSNEDKIMVLDSHKLMGASGEAGDRAQFTEYVQKNVSLYQFRNGIPLTTKAAANFMRGELATALRKNPYMVNIVLAGYDKETGPSLYFIDYIATLHKVDKAAFGYGSYFSLAMMDRHYRPDMTVDEAIHLADQCIEEIRSRLVVAPQNFVIKIVDKDGAREHSWRRTTKD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G560900`
TK1151 ID	TkA03G560900
OH-1004 ID	LXL04_011019
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G560900

Location Chr03:142252856-142254666 (+)

Description Similar to PBD1: Proteasome subunit beta type-2-A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22630`	Non-catalytic component of the proteasome, a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release
`At4g14800`	Non-catalytic component of the proteasome, a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0695600`	Non-catalytic component of the proteasome, a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011019 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005839 proteasome core complex Cellular Component

KEGG gene cross-reference

ath:AT3G22630

ath:AT4G14800

ddi:DDB_G0269472

dosa:Os03g0695600

spo:2543122

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.728

Rank 1 · TkA03G560900 · TK1151

Cytoplasm0.621

Rank 2 · TkA03G560900 · TK1151

Cell membrane0.031

Rank 3 · TkA03G560900 · TK1151

Mitochondrion0.030

Rank 4 · TkA03G560900 · TK1151

Endoplasmic reticulum0.027

Rank 5 · TkA03G560900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00227Proteasome3-182 aa

PF10825DUF275276-102 aa

PF13778DUF417482-108 aa

PF13778DUF4174156-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G560900	`PF00227`	Proteasome	3	182	1.6e-44	152.5
TkA03G560900	`PF10825`	DUF2752	76	102	0.11	13.3
TkA03G560900	`PF13778`	DUF4174	82	108	0.13	13.5
TkA03G560900	`PF13778`	DUF4174	156	193	0.13	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23714`	Arabidopsis thaliana	sp\|O23714\|PSB2A_ARATH Proteasome subunit beta type-2-A	80.800%	Swiss-Prot	High
`O24633`	Arabidopsis thaliana	sp\|O24633\|PSB2B_ARATH Proteasome subunit beta type-2-B	80.300%	Swiss-Prot	High
`Q9LST6`	Oryza sativa subsp. japonica	sp\|Q9LST6\|PSB2_ORYSJ Proteasome subunit beta type-2	73.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card