TkA03G559720 | RubberDandelionOmics

Gene overview

TkA03G559720

Reference: TK1151 Chr: Chr03 Coordinates: 141932950-141933926 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

843 bp · TkA03G559720|TK1151|cDNA

ATGAAGCACAAACATGGCTGGGTGTTCAACAAACCTGTTGATCCCCTTGCCCTTGGTTTACATGATTACTTTGACATCATCAAACATCCAATGGATTTAGAAACTGTGAAATCCCGTTTGGATAAAAACTGGTATAATTCACCAATGGAGTTTGCAGAAGATGTAAGACTTACATTCCATAATGCCATGACATATAACCCAAAAGGGCAAGATGTTCATGCCATGGCGGAACTTCTGTTGAATTTATTTCAAGAAAAATG...

CDS

Download CDS FASTA

843 bp · TkA03G559720|TK1151|CDS

ATGAAGCACAAACATGGCTGGGTGTTCAACAAACCTGTTGATCCCCTTGCCCTTGGTTTACATGATTACTTTGACATCATCAAACATCCAATGGATTTAGAAACTGTGAAATCCCGTTTGGATAAAAACTGGTATAATTCACCAATGGAGTTTGCAGAAGATGTAAGACTTACATTCCATAATGCCATGACATATAACCCAAAAGGGCAAGATGTTCATGCCATGGCGGAACTTCTGTTGAATTTATTTCAAGAAAAATG...

Protein

Download Protein FASTA

280 aa · TkA03G559720|TK1151|PROTEIN

MKHKHGWVFNKPVDPLALGLHDYFDIIKHPMDLETVKSRLDKNWYNSPMEFAEDVRLTFHNAMTYNPKGQDVHAMAELLLNLFQEKWKVLEADYIRESKLSVKVSTIEPKSKPMNVSNMGRNVIRPSSSKKPKAKEVNKREMTYDEKQKLSMDLQNLPSEKLDNVVQIIKKRNPSLSQKDDEIEVDIDTFDTETLWELDRFVTNYKKGLNKNKRKLIFQIKKQSKNQTYRKTNVPLITVDDAPKEVEKKVEEEVAGGDHK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G559720`
TK1151 ID	TkA03G559720
OH-1004 ID	LXL04_010992
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.400
Protein coverage (%)	TK1151 89.643 / OH-1004 53.479 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G559720

Location Chr03:141932950-141933926 (-)

Description Similar to GTE4: Transcription factor GTE4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06230`	Involved in the activation and maintenance of cell division in the meristems and by this controls cell numbers in differentiated organs.	The Arabidopsis BET bromodomain factor GTE4 is involved in maintenance of the mitotic cell cycle during plant development.2010 · DOI: 10.1104/pp.109.150631 The Arabidopsis BET bromodomain factor GTE4 regulates the mitotic cell cycle.2010 · DOI: 10.4161/psb.5.6.11571
`At1g73150`	Probable transcription factor that binds to acetylated histone H3.	The PHD domain of plant PIAS proteins mediates sumoylation of bromodomain GTE proteins.2008 · DOI: 10.1074/jbc.m708176200
`At1g17790`	Transcription factor GTE5, chloroplastic.	No verified direct reference in this release
`At5g65630`	Transcription factor GTE7.	No verified direct reference in this release
`At5g10550`	Transcription factor GTE2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010992 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009294 DNA-mediated transformation Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045931 positive regulation of mitotic cell cycle Biological Process

GO:0048364 root development Biological Process

KEGG gene cross-reference

ath:AT1G06230

ath:AT1G17790

ath:AT1G73150

ath:AT5G14270

ath:AT5G63320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.838

Rank 1 · TkA03G559720 · TK1151

Cytoplasm0.226

Rank 2 · TkA03G559720 · TK1151

Cell membrane0.034

Rank 3 · TkA03G559720 · TK1151

Endoplasmic reticulum0.022

Rank 4 · TkA03G559720 · TK1151

Mitochondrion0.018

Rank 5 · TkA03G559720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00439Bromodomain2-77 aa

PF17035BET141-203 aa

PF02520ANIS5_cation-bd146-221 aa

PF00439Bromodomain217-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G559720	`PF00439`	Bromodomain	2	77	4e-18	65.9
TkA03G559720	`PF17035`	BET	141	203	3.7e-25	88.5
TkA03G559720	`PF02520`	ANIS5_cation-bd	146	221	0.037	14.4
TkA03G559720	`PF00439`	Bromodomain	217	231	4e-18	65.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNC4`	Arabidopsis thaliana	sp\|Q9LNC4\|GTE4_ARATH Transcription factor GTE4	54.800%	Swiss-Prot	High
`Q9S7T1`	Arabidopsis thaliana	sp\|Q9S7T1\|GTE3_ARATH Transcription factor GTE3, chloroplastic	49.800%	Swiss-Prot	Medium
`Q8H1D7`	Arabidopsis thaliana	sp\|Q8H1D7\|GTE5_ARATH Transcription factor GTE5, chloroplastic	44.500%	Swiss-Prot	Medium
`Q7Y214`	Arabidopsis thaliana	sp\|Q7Y214\|GTE7_ARATH Transcription factor GTE7	39.900%	Swiss-Prot	Medium
`Q9LXA7`	Arabidopsis thaliana	sp\|Q9LXA7\|GTE2_ARATH Transcription factor GTE2	39.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card