TkA03G559670 | RubberDandelionOmics

Gene overview

TkA03G559670

Reference: TK1151 Chr: Chr03 Coordinates: 141911713-141913764 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1312 bp · TkA03G559670|TK1151|cDNA

ATAGGAAGTTCGAACCGAAAACAGAAATAGAAAGTTAAATTCGATTTAAAGTTCTTCCACAGTGGACTCTCACTCTCACCAGCCAATTTTTAAGCGTCAATCCTGCGAAAATGGAGAAACCCTACAAAAAAGAAGTGCTTCTCTTCTATTGCGTGGAATCCGAAGAACTTGCTCGCAAGATTTCCGCTCAATCCGACCTCATTCAGCTCCAATCCATCAATTGGAGGAGTTTCGACGACGGATTCCCAAACTTATTCATA...

CDS

Download CDS FASTA

957 bp · TkA03G559670|TK1151|CDS

ATGGAGAAACCCTACAAAAAAGAAGTGCTTCTCTTCTATTGCGTGGAATCCGAAGAACTTGCTCGCAAGATTTCCGCTCAATCCGACCTCATTCAGCTCCAATCCATCAATTGGAGGAGTTTCGACGACGGATTCCCAAACTTATTCATAAACAACGCACAAGAAATCAGAGGCCAGCATGTTGCTTTCCTCGCATCATTCAGCTCTCCAGCTGTCATCTTCGAACAGCTATCCGTCATATTTGCACTCCCTAGACTTTT...

Protein

Download Protein FASTA

318 aa · TkA03G559670|TK1151|PROTEIN

MEKPYKKEVLLFYCVESEELARKISAQSDLIQLQSINWRSFDDGFPNLFINNAQEIRGQHVAFLASFSSPAVIFEQLSVIFALPRLFVASFTLVLPFFPTGSFERMEEEGDVATAFTMARILSNIPVSRGGPTSLVIYDIHALQERFYFGDHVLPCFETGMPLLKQRLHQLPDANDVVIAFPDDGAWKRFHKQLDHFPTVVCAKVREGDKRIVRLKEGDPKGRHVVIVDDLVQSGGTLIECQKVLAAHGATKVSAYVTHA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G559670`
TK1151 ID	TkA03G559670
OH-1004 ID	LXL04_010986
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 74.648 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G559670

Location Chr03:141911713-141913764 (-)

Description Similar to PRS4: Ribose-phosphate pyrophosphokinase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42910`	Ribose-phosphate pyrophosphokinase 4.	No verified direct reference in this release
`At1g10700`	Ribose-phosphate pyrophosphokinase 3, chloroplastic.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0714600`	Ribose-phosphate pyrophosphokinase 4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010986 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006015 5-phosphoribose 1-diphosphate biosynthetic process Biological Process

GO:0006164 purine nucleotide biosynthetic process Biological Process

GO:0002189 ribose phosphate diphosphokinase complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004749 ribose phosphate diphosphokinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G10700

ath:AT2G42910

dosa:Os02g0714600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.668

Rank 1 · TkA03G559670 · TK1151

Nucleus0.429

Rank 2 · TkA03G559670 · TK1151

Mitochondrion0.073

Rank 3 · TkA03G559670 · TK1151

Cell membrane0.049

Rank 4 · TkA03G559670 · TK1151

Endoplasmic reticulum0.042

Rank 5 · TkA03G559670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13793Pribosyltran_N11-124 aa

PF00156Pribosyltran151-260 aa

PF14572Pribosyl_synth218-264 aa

PF13793Pribosyltran_N219-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G559670	`PF13793`	Pribosyltran_N	11	124	2.5e-08	34.5
TkA03G559670	`PF00156`	Pribosyltran	151	260	6.6e-11	42.5
TkA03G559670	`PF14572`	Pribosyl_synth	218	264	0.00017	22.3
TkA03G559670	`PF13793`	Pribosyltran_N	219	264	2.5e-08	34.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q680A5`	Arabidopsis thaliana	sp\|Q680A5\|KPRS4_ARATH Ribose-phosphate pyrophosphokinase 4	82.400%	Swiss-Prot	High
`Q93Z66`	Arabidopsis thaliana	sp\|Q93Z66\|KPRS3_ARATH Ribose-phosphate pyrophosphokinase 3, chloroplastic	75.700%	Swiss-Prot	High
`Q6ZFT5`	Oryza sativa subsp. japonica	sp\|Q6ZFT5\|KPRS4_ORYSJ Ribose-phosphate pyrophosphokinase 4	80.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card