TkA03G558070 | RubberDandelionOmics

Gene overview

TkA03G558070

Reference: TK1151 Chr: Chr03 Coordinates: 141279813-141281308 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1284 bp · TkA03G558070|TK1151|cDNA

TTATCAGGAAGTGAAAGGCCAAAAAATGAGATCCAAAGTGCGAATGTGGATAGGCTTAGTGTTTTGCCTGACGAGCTTCTTGCACACATTCTTTCTTCAATGCCTACAAAATCAGCAGTGAGGACAAGCATTTTATCCAAAAGATGGAGACATTGTTGGACATTGGTGCATAGCCTTGACTTCCTCCATATTAACCACACACGTGATTCTTCTACCTTTTCTAGTTTTGTGGATCGGGCGCTAGAGCTTTGTAAACCACC...

CDS

Download CDS FASTA

1284 bp · TkA03G558070|TK1151|CDS

TTATCAGGAAGTGAAAGGCCAAAAAATGAGATCCAAAGTGCGAATGTGGATAGGCTTAGTGTTTTGCCTGACGAGCTTCTTGCACACATTCTTTCTTCAATGCCTACAAAATCAGCAGTGAGGACAAGCATTTTATCCAAAAGATGGAGACATTGTTGGACATTGGTGCATAGCCTTGACTTCCTCCATATTAACCACACACGTGATTCTTCTACCTTTTCTAGTTTTGTGGATCGGGCGCTAGAGCTTTGTAAACCACC...

Protein

Download Protein FASTA

427 aa · TkA03G558070|TK1151|PROTEIN

LSGSERPKNEIQSANVDRLSVLPDELLAHILSSMPTKSAVRTSILSKRWRHCWTLVHSLDFLHINHTRDSSTFSSFVDRALELCKPPQLKLFRLQICGILVNNPHVPKWINEAVRLNVGELDINVSVRELPLSLFTCKTLTKLRLVVGACGSHAMMNVPRGVILPCLKTLNIGLFHEPFVSVCKLVRGCPILESFCLSIKVPRRHENNQKYNINIPTLKRFELRTPKLTFNISKVILNVPNLEYFIVSGSMCSLFVMEDF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G558070`
TK1151 ID	TkA03G558070
OH-1004 ID	LXL04_035646
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	48.600
Protein coverage (%)	TK1151 99.766 / OH-1004 90.678 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G558070

Location Chr03:141279813-141281308 (-)

Description Similar to At4g10400: FBD-associated F-box protein At4g10400

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26340`	F-box/FBD/LRR-repeat protein At4g26340.	No verified direct reference in this release
`At4g10400`	FBD-associated F-box protein At4g10400.	No verified direct reference in this release
`At5g56370`	FBD-associated F-box protein At5g56370.	No verified direct reference in this release
`At2g26860`	FBD-associated F-box protein At2g26860.	No verified direct reference in this release
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035646 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13780

ath:AT1G78750

ath:AT1G78760

ath:AT4G10400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.840

Rank 1 · TkA03G558070 · TK1151

Cytoplasm0.241

Rank 2 · TkA03G558070 · TK1151

Cell membrane0.034

Rank 3 · TkA03G558070 · TK1151

Endoplasmic reticulum0.033

Rank 4 · TkA03G558070 · TK1151

Plastid0.016

Rank 5 · TkA03G558070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box19-57 aa

PF12937F-box-like20-52 aa

PF24758LRR_At5g56370108-251 aa

PF08387FBD166-172 aa

PF24758LRR_At5g56370296-342 aa

PF08387FBD350-395 aa

PF24758LRR_At5g56370370-402 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G558070	`PF00646`	F-box	19	57	4.2e-10	39.8
TkA03G558070	`PF12937`	F-box-like	20	52	3.8e-05	24.1
TkA03G558070	`PF24758`	LRR_At5g56370	108	251	3.7e-13	50.4
TkA03G558070	`PF08387`	FBD	166	172	2.5e-13	50.4
TkA03G558070	`PF24758`	LRR_At5g56370	296	342	3.7e-13	50.4
TkA03G558070	`PF08387`	FBD	350	395	2.5e-13	50.4
TkA03G558070	`PF24758`	LRR_At5g56370	370	402	3.7e-13	50.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1R7`	Arabidopsis thaliana	sp\|Q8H1R7\|FDL27_ARATH F-box/FBD/LRR-repeat protein At4g26340	28.900%	Swiss-Prot	Low
`Q9SV82`	Arabidopsis thaliana	sp\|Q9SV82\|FBD40_ARATH FBD-associated F-box protein At4g10400	31.600%	Swiss-Prot	Medium
`Q9FM94`	Arabidopsis thaliana	sp\|Q9FM94\|FBD21_ARATH FBD-associated F-box protein At5g56370	30.900%	Swiss-Prot	Medium
`Q84X02`	Arabidopsis thaliana	sp\|Q84X02\|FBD7_ARATH FBD-associated F-box protein At2g26860	30.700%	Swiss-Prot	Medium
`Q9FM89`	Arabidopsis thaliana	sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420	29.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card