TkA03G557480 | RubberDandelionOmics

Gene overview

TkA03G557480

Reference: TK1151 Chr: Chr03 Coordinates: 141101239-141102635 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1185 bp · TkA03G557480|TK1151|cDNA

ATGCCTACAAAATCAGCAGTGAGGACAAGCATTTTATCCAAAAGATGGAGACATTGTTGGACATTGGTGCATAGCCTTGACTTCCTCCATATTAACAACCACACACTTGATTCTTCTAGCTTTTCTAGTTTTGTGGATCGGGCGCTAGAGCTTTGTAAACCACCCCGACTTGAGTTATTCCGGTTACAATTATGTGGATTAACTATTGTTGGAAATCCAAACGTGCCAAAGTGGATTAATGAAGCGGTTAGGTTAAATGT...

CDS

Download CDS FASTA

1185 bp · TkA03G557480|TK1151|CDS

ATGCCTACAAAATCAGCAGTGAGGACAAGCATTTTATCCAAAAGATGGAGACATTGTTGGACATTGGTGCATAGCCTTGACTTCCTCCATATTAACAACCACACACTTGATTCTTCTAGCTTTTCTAGTTTTGTGGATCGGGCGCTAGAGCTTTGTAAACCACCCCGACTTGAGTTATTCCGGTTACAATTATGTGGATTAACTATTGTTGGAAATCCAAACGTGCCAAAGTGGATTAATGAAGCGGTTAGGTTAAATGT...

Protein

Download Protein FASTA

394 aa · TkA03G557480|TK1151|PROTEIN

MPTKSAVRTSILSKRWRHCWTLVHSLDFLHINNHTLDSSSFSSFVDRALELCKPPRLELFRLQLCGLTIVGNPNVPKWINEAVRLNVGELDINVCVRELPLSLFTSKTLTKLRLVVGACGSHVMINVPRGVILPCLKTLDIRLFHEPLSVRKLIRGCPVLESFCLSIIPRRYENDKKYKINIPTLKRFELRTLTRTFDISKVILNVPNLEYFIVSGSMCSLFVMEDFPCLVEASISFHEVVYKHLMIELLKGLSGAKSLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G557480`
TK1151 ID	TkA03G557480
OH-1004 ID	LXL04_035646
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	50.800
Protein coverage (%)	TK1151 99.746 / OH-1004 83.263 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G557480

Location Chr03:141101239-141102635 (-)

Description Similar to At4g10400: FBD-associated F-box protein At4g10400

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50710`	Putative FBD-associated F-box protein At3g50710.	No verified direct reference in this release
`At2g26860`	FBD-associated F-box protein At2g26860.	No verified direct reference in this release
`At4g10400`	FBD-associated F-box protein At4g10400.	No verified direct reference in this release
`At4g00315`	Putative F-box/FBD/LRR-repeat protein At4g00315.	No verified direct reference in this release
`At4g15060`	Putative F-box/LRR-repeat protein At4g15060.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035646 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13780

ath:AT1G78750

ath:AT1G78760

ath:AT4G10400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.821

Rank 1 · TkA03G557480 · TK1151

Cytoplasm0.273

Rank 2 · TkA03G557480 · TK1151

Endoplasmic reticulum0.035

Rank 3 · TkA03G557480 · TK1151

Cell membrane0.032

Rank 4 · TkA03G557480 · TK1151

Plastid0.018

Rank 5 · TkA03G557480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box1-24 aa

PF23598LRR_1421-179 aa

PF24758LRR_At5g5637025-60 aa

PF24758LRR_At5g5637077-218 aa

PF08387FBD133-147 aa

PF07723LRR_2135-158 aa

PF23598LRR_14225-248 aa

PF24758LRR_At5g56370263-308 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G557480	`PF00646`	F-box	1	24	0.01	16.5
TkA03G557480	`PF23598`	LRR_14	21	179	0.0067	15.9
TkA03G557480	`PF24758`	LRR_At5g56370	25	60	4e-12	47.0
TkA03G557480	`PF24758`	LRR_At5g56370	77	218	4e-12	47.0
TkA03G557480	`PF08387`	FBD	133	147	9.3e-14	51.8
TkA03G557480	`PF07723`	LRR_2	135	158	0.17	13.3
TkA03G557480	`PF23598`	LRR_14	225	248	0.0067	15.9
TkA03G557480	`PF24758`	LRR_At5g56370	263	308	4e-12	47.0
TkA03G557480	`PF23598`	LRR_14	274	334	0.0067	15.9
TkA03G557480	`PF07723`	LRR_2	276	287	0.17	13.3
TkA03G557480	`PF08387`	FBD	317	362	9.3e-14	51.8
TkA03G557480	`PF24758`	LRR_At5g56370	346	369	4e-12	47.0
TkA03G557480	`PF07723`	LRR_2	357	371	0.17	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCQ5`	Arabidopsis thaliana	sp\|Q9SCQ5\|FBD10_ARATH Putative FBD-associated F-box protein At3g50710	28.800%	Swiss-Prot	Low
`Q84X02`	Arabidopsis thaliana	sp\|Q84X02\|FBD7_ARATH FBD-associated F-box protein At2g26860	30.500%	Swiss-Prot	Medium
`Q9SV82`	Arabidopsis thaliana	sp\|Q9SV82\|FBD40_ARATH FBD-associated F-box protein At4g10400	31.300%	Swiss-Prot	Medium
`Q3EAE5`	Arabidopsis thaliana	sp\|Q3EAE5\|FDL24_ARATH Putative F-box/FBD/LRR-repeat protein At4g00315	27.200%	Swiss-Prot	Low
`O23360`	Arabidopsis thaliana	sp\|O23360\|FBL93_ARATH Putative F-box/LRR-repeat protein At4g15060	29.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card