TkA03G557210 | RubberDandelionOmics

Gene overview

TkA03G557210

Reference: TK1151 Chr: Chr03 Coordinates: 141030402-141039186 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1152 bp · TkA03G557210|TK1151|cDNA

GAAGATAATTAAACATTGATCGCCTATCTACAATAAAAAATAAAAACCACCTTATAAAACAACTTACAGAACCACACATCTTCATCACTCAAACTCTTCCACCTACACAACATCATCCAAACAAAAATGGCAGCTTCCACCATGGCTCTATTCTCCTCTTTTGTTGGACAAGCAGTGAAAGTAGCACCATCCGGTTCAGAAATCATCGGAAATGGAAGGGTTTCCATGAGGAAGGCAGCAGTCAAGAAGGTCGCCCCATC...

CDS

Download CDS FASTA

798 bp · TkA03G557210|TK1151|CDS

ATGGCAGCTTCCACCATGGCTCTATTCTCCTCTTTTGTTGGACAAGCAGTGAAAGTAGCACCATCCGGTTCAGAAATCATCGGAAATGGAAGGGTTTCCATGAGGAAGGCAGCAGTCAAGAAGGTCGCCCCATCAGGAAGCCCATGGTACGGCCCAGAACGCGTTAAGTACCTTGGCCCATTCTCCGGGGAAGCCCCATCTTACCTGACCGGAGAGTTCCCCGGTGACTACGGTTGGGACACTGCCGGACTCTCTGCCGA...

Protein

Download Protein FASTA

265 aa · TkA03G557210|TK1151|PROTEIN

MAASTMALFSSFVGQAVKVAPSGSEIIGNGRVSMRKAAVKKVAPSGSPWYGPERVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANNAWSYATN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G557210`
TK1151 ID	TkA03G557210
OH-1004 ID	LXL04_010946
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G557210`
Location	Chr03:141030402-141039186 (+)
Description	Similar to CAB3C: Chlorophyll a-b binding protein 3C, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010946` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009416 response to light stimulus Biological Process GO:0009768 photosynthesis, light harvesting in photosystem I Biological Process GO:0009522 photosystem I Cellular Component GO:0009523 photosystem II Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0016168 chlorophyll binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	nta:107764358 nta:107773232 nta:107775016 sly:101264784 sly:101265886 sly:108491835 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.986

Rank 1 · TkA03G557210 · TK1151

Mitochondrion0.027

Rank 2 · TkA03G557210 · TK1151

Cytoplasm0.018

Rank 3 · TkA03G557210 · TK1151

Nucleus0.009

Rank 4 · TkA03G557210 · TK1151

Cell membrane0.009

Rank 5 · TkA03G557210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00504Chloroa_b-bind29-34 aa

PF00504Chloroa_b-bind65-231 aa

PF31213HliA98-123 aa

PF31213HliA213-238 aa

PF10143PhosphMutase219-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G557210	`PF00504`	Chloroa_b-bind	29	34	3.7e-51	174.5
TkA03G557210	`PF00504`	Chloroa_b-bind	65	231	3.7e-51	174.5
TkA03G557210	`PF31213`	HliA	98	123	0.011	16.4
TkA03G557210	`PF31213`	HliA	213	238	0.011	16.4
TkA03G557210	`PF10143`	PhosphMutase	219	243	0.26	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card