TkA03G557200 | RubberDandelionOmics

Gene overview

TkA03G557200

Reference: TK1151 Chr: Chr03 Coordinates: 141024777-141025181 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

405 bp · TkA03G557200|TK1151|cDNA

ATGGAAATGCTTCCTGTTAAACCCACAAAGAAGTCATGCACCAATAAAAAGAAACACACCAACAAGCTTAAAGTGGTCTATATATCTTCTCCCATGAAGGTCACGACCAGTGCCTCCAGGTTCCGAACTCTTGTCCAGGAGCTCACAGGTCGTGACTCTGATATTAGCCGGTATGATGTTGGGTACTTTGATACTGTTGCACCAGCGGCCATGACTACAACCACAAGTACACAAGGTAGTTCACATTCACAAGGTGGCTC...

CDS

Download CDS FASTA

405 bp · TkA03G557200|TK1151|CDS

ATGGAAATGCTTCCTGTTAAACCCACAAAGAAGTCATGCACCAATAAAAAGAAACACACCAACAAGCTTAAAGTGGTCTATATATCTTCTCCCATGAAGGTCACGACCAGTGCCTCCAGGTTCCGAACTCTTGTCCAGGAGCTCACAGGTCGTGACTCTGATATTAGCCGGTATGATGTTGGGTACTTTGATACTGTTGCACCAGCGGCCATGACTACAACCACAAGTACACAAGGTAGTTCACATTCACAAGGTGGCTC...

Protein

Download Protein FASTA

134 aa · TkA03G557200|TK1151|PROTEIN

MEMLPVKPTKKSCTNKKKHTNKLKVVYISSPMKVTTSASRFRTLVQELTGRDSDISRYDVGYFDTVAPAAMTTTTSTQGSSHSQGGSVDGKAVEYGDQQGLRFSGSESLLDDDDVFRVDQLEGIFPLLYESCLQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G557200`
TK1151 ID	TkA03G557200
OH-1004 ID	LXL04_010945
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G557200

Location Chr03:141024777-141025181 (+)

Description Similar to SIB1: Sigma factor binding protein 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56710`	Contributes to plant defense.	The Arabidopsis gene SIGMA FACTOR-BINDING PROTEIN 1 plays a role in the salicylate- and jasmonate-mediated defence responses.2010 · DOI: 10.1111/j.1365-3040.2009.02109.x Arabidopsis sigma factor binding proteins are activators of the WRKY33 transcription factor in plant defense.2011 · DOI: 10.1105/tpc.111.090571

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010945 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0042742 defense response to bacterium Biological Process

GO:0071482 cellular response to light stimulus Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G41180

ath:AT3G56710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.957

Rank 1 · TkA03G557200 · TK1151

Cytoplasm0.124

Rank 2 · TkA03G557200 · TK1151

Endoplasmic reticulum0.041

Rank 3 · TkA03G557200 · TK1151

Cell membrane0.036

Rank 4 · TkA03G557200 · TK1151

Plastid0.014

Rank 5 · TkA03G557200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05678VQ28-54 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G557200	`PF05678`	VQ	28	54	3.5e-10	39.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDH1`	Arabidopsis thaliana	sp\|Q9LDH1\|SIB1_ARATH Sigma factor binding protein 1, chloroplastic	57.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card