TkA03G553520 | RubberDandelionOmics

Gene overview

TkA03G553520

Reference: TK1151 Chr: Chr03 Coordinates: 140142025-140145508 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1431 bp · TkA03G553520|TK1151|cDNA

CGGGAGTTGATTTCAGGACCCGGCAGCCCTTTCACGCACGTCGTCGCCATATGCTCCTTTCTCCCACCGACTCTCCTCCGCCGGATGCTTGTCCGCCAGTTCAGATACTCTTTTGCCGGCGCCGGTTACGGCCCATCTTCTCCAGAGGACGCCGGCGCTGTCCCTTCCGAACATTGTCGATCGATTCTTCTTCTCCAGAAACCGATTCTAATGCTTCTTTCATATTCAGATTTCTGGACTTTAGAAAAGCTGATTTCAGG...

CDS

Download CDS FASTA

585 bp · TkA03G553520|TK1151|CDS

ATGGCCGAATATCAGTCGTGCACAGCTTGTAGCAATCCTACCATTGGCTATAATGCACACCTTAGATACCAAACACTATGGGTAGTGACCTCCCTTTTACCTATTGTTGGGGGAGTAGGACTTGCATCTCTCACTGAGGTGTCGTTTAATTGGCCTGGGTTTTGGAGTGCAATGGCATCTAATTTGGCAAATCAATCACGCAATGTACTAAGCAAAAAAGTTATGGTTCAGAAAGAGGAACCATTGGACAACATTACCCT...

Protein

Download Protein FASTA

194 aa · TkA03G553520|TK1151|PROTEIN

MAEYQSCTACSNPTIGYNAHLRYQTLWVVTSLLPIVGGVGLASLTEVSFNWPGFWSAMASNLANQSRNVLSKKVMVQKEEPLDNITLFSIITIMSFFMFTPVALLVEGVKFTPAYLQSAGLNLKLVYIRYFLASICFHAYQQVAYMILQRVSPVTHCVGNCVKRVVVIVSSIFFFRTPVSLINSIGFKVDNIMR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G553520`
TK1151 ID	TkA03G553520
OH-1004 ID	LXL04_007010
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.000
Protein coverage (%)	TK1151 94.845 / OH-1004 51.020 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G553520

Location Chr03:140142025-140145508 (+)

Description Similar to PPT2: Phosphoenolpyruvate/phosphate translocator 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g33320`	Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP), 2-phosphoglycerate, 3-phosphoglycerate and dihydroxyacetone phosphate.	The phosphoenolpyruvate/phosphate translocator is required for phenolic metabolism, palisade cell development, and plastid-dependent nuclear gene expression.1999 · DOI: 10.1105/tpc.11.9.1609 The phenotype of the Arabidopsis cue1 mutant is not simply caused by a general restriction of the shikimate pathway.2003 · DOI: 10.1046/j.1365-313x.2003.01889.x Characterization of two functional phosphoenolpyruvate/phosphate translocator (PPT) genes in Arabidopsis--AtPPT1 may be involved in the provision of signals for correct mesophyll development.2003 · DOI: 10.1046/j.1365-313x.2003.01888.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0344600`	Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP) and dihydroxyacetone phosphate.	No verified direct reference in this release
`Os09g0297400`	Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP) and dihydroxyacetone phosphate.	No verified direct reference in this release
`Os01g0172100`	Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP) and dihydroxyacetone phosphate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007010 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015713 phosphoglycerate transmembrane transport Biological Process

GO:0015714 phosphoenolpyruvate transport Biological Process

GO:0035436 triose phosphate transmembrane transport Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009528 plastid inner membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0009670 triose-phosphate:phosphate antiporter activity Molecular Function

GO:0015120 phosphoglycerate transmembrane transporter activity Molecular Function

GO:0015121 phosphoenolpyruvate:phosphate antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G33320

dosa:Os01g0172100

dosa:Os08g0344600

dosa:Os09g0297400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.463

Rank 1 · TkA03G553520 · TK1151

Golgi apparatus0.425

Rank 2 · TkA03G553520 · TK1151

Cytoplasm0.082

Rank 3 · TkA03G553520 · TK1151

Cell membrane0.047

Rank 4 · TkA03G553520 · TK1151

Nucleus0.046

Rank 5 · TkA03G553520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03151TPT23-189 aa

PF06471CoV_ExoN111-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G553520	`PF03151`	TPT	23	189	1.9e-66	225.1
TkA03G553520	`PF06471`	CoV_ExoN	111	162	0.027	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXN3`	Arabidopsis thaliana	sp\|Q8RXN3\|PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic	69.100%	Swiss-Prot	High
`Q84QU8`	Oryza sativa subsp. japonica	sp\|Q84QU8\|PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic	75.900%	Swiss-Prot	High
`Q69VR7`	Oryza sativa subsp. japonica	sp\|Q69VR7\|PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic	76.500%	Swiss-Prot	High
`Q5VQL3`	Oryza sativa subsp. japonica	sp\|Q5VQL3\|PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic	64.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card