TkA03G551020 | RubberDandelionOmics

Gene overview

TkA03G551020

Reference: TK1151 Chr: Chr03 Coordinates: 139465896-139468698 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1786 bp · TkA03G551020|TK1151|cDNA

GAACATGCCCTCCAACTGTCATCCACCTCCCTCGTTCTTTCTCTCTCTAGGACTCGTTCCCTCTCTCTCTCTGGGACATATGTAGTGTAGTGATCCAAATACAAAAACAAAGCAAGGAATAGTTATGGCTGTCTTTTTTTCCCATCCATACGTTTCCCTCTCTTCTTCTTCTTCTCCTTTGCTTTTACTTCCTCGTTGAAAAAAATTGATGACGTCCCTCTTCAGATCCAAATCCTGCGGTGGAGTCCCCCGCCCCAAAT...

CDS

Download CDS FASTA

1224 bp · TkA03G551020|TK1151|CDS

ATGACGTCCCTCTTCAGATCCAAATCCTGCGGTGGAGTCCCCCGCCCCAAATCCTCCCTTTTCCACTACTCTTCTTCCCCCAATCAACAACCTGATGATGACGACGGCGACATTTGTTACTACGATTATTCCTACTTTAATAACAACAGTCCAATTACAACCCCCTTTATCAGTCCCCGCCAACAGGGTCCCGCCCAATCCAATCCCAATTTCACCATCGCCTCGCTCTTGTTGGCCGCCCTACGGAAATCTCTCCTCAC...

Protein

Download Protein FASTA

407 aa · TkA03G551020|TK1151|PROTEIN

MTSLFRSKSCGGVPRPKSSLFHYSSSPNQQPDDDDGDICYYDYSYFNNNSPITTPFISPRQQGPAQSNPNFTIASLLLAALRKSLLTCTVHDPDDVSSSLDIGIPTNVQHVAHVTFDRFNGFLGLPLALQPDVPGEVPSASVCVFGVSVESMQCSYDKRGNSVPTILLMLQKRLYSEGGLQAEGIFRINGENGQEEDVRKHLNRGFVPRGVDVHCLAGLIKAWFRELPTGVLDTLTPQQVMHCNTEEECTKLVETLPPTE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G551020`
TK1151 ID	TkA03G551020
OH-1004 ID	LXL04_018856
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	65.600
Protein coverage (%)	TK1151 65.602 / OH-1004 61.765 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G551020

Location Chr03:139465896-139468698 (+)

Description Similar to ROPGAP2: Rho GTPase-activating protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46710`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release
`At4g03100`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release
`At5g22400`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release
`At3g11490`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	RopGAP4-dependent Rop GTPase rheostat control of Arabidopsis oxygen deprivation tolerance.2002 · DOI: 10.1126/science.1071505
`At1g08340`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018856 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0034059 response to anoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009531 secondary cell wall Cellular Component

GO:0005096 GTPase activator activity Molecular Function

KEGG gene cross-reference

ath:AT1G08340

ath:AT2G46710

ath:AT3G11490

ath:AT4G03100

ath:AT5G22400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.382

Rank 1 · TkA03G551020 · TK1151

Nucleus0.282

Rank 2 · TkA03G551020 · TK1151

Cell membrane0.229

Rank 3 · TkA03G551020 · TK1151

Golgi apparatus0.104

Rank 4 · TkA03G551020 · TK1151

Endoplasmic reticulum0.088

Rank 5 · TkA03G551020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00786PBD11-34 aa

PF00786PBD101-130 aa

PF00620RhoGAP164-297 aa

PF00786PBD241-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G551020	`PF00786`	PBD	11	34	8.8e-06	26.7
TkA03G551020	`PF00786`	PBD	101	130	8.8e-06	26.7
TkA03G551020	`PF00620`	RhoGAP	164	297	8.3e-22	78.4
TkA03G551020	`PF00786`	PBD	241	265	8.8e-06	26.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYY5`	Arabidopsis thaliana	sp\|Q8GYY5\|RGAP3_ARATH Rho GTPase-activating protein 3	54.800%	Swiss-Prot	High
`F4JI46`	Arabidopsis thaliana	sp\|F4JI46\|RGAP2_ARATH Rho GTPase-activating protein 2	65.700%	Swiss-Prot	Medium
`Q9FMR1`	Arabidopsis thaliana	sp\|Q9FMR1\|RGAP1_ARATH Rho GTPase-activating protein 1	66.800%	Swiss-Prot	Medium
`Q9CAX8`	Arabidopsis thaliana	sp\|Q9CAX8\|RGAP4_ARATH Rho GTPase-activating protein 4	66.300%	Swiss-Prot	Medium
`Q6NKT5`	Arabidopsis thaliana	sp\|Q6NKT5\|RGAP5_ARATH Rho GTPase-activating protein 5	68.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card