RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G547580
Reference: TK1151 Chr: Chr03 Coordinates: 138128055-138131658 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2847 bp · TkA03G547580|TK1151|cDNA

AAAAAAAAAAAGTACACCCCGTCCCCAGCGCTGAGCTACTTTTGATTTTTATCGTCTTCTCATTCCTCTTTTCCCCTTGGATTTTTACTCAATCTTCACAAAACTCCCAAACTTCTCTTTTCTGTCCATGTAAGATTTCATGGGTTTCCCATAGATTTTCAAATCAGAATCTTTCCCCTTCCTCCTGCAAAAACCCACAAAATCTATCTCTATATTCTGTTCCATACTGAACTCGCTCAATAATTTCTGCAAACATAAAG...

CDS

Download CDS FASTA

1089 bp · TkA03G547580|TK1151|CDS

ATGAGATGCGCAGCGTGTTCGGAAGTGATGTCGCTTTCAATTGTCAACAATAAACTTCTTCTATCGATTTATACGATAACTCGCACGGATTCCGAAAACCCAAAAGACGATCACAAGACACGTGGAGACACAAAATGGGGCGGCACTGAGGTTTCATCAGAGGATTACGATAACTCTGGTAATTTTGACTTTGAGTCAATGGATAAATTAGCGTTAGCCGGACCAAGTTTGACGTCTTACAAATCCGCGGTTTCTTATGC...

Protein

Download Protein FASTA

362 aa · TkA03G547580|TK1151|PROTEIN

MRCAACSEVMSLSIVNNKLLLSIYTITRTDSENPKDDHKTRGDTKWGGTEVSSEDYDNSGNFDFESMDKLALAGPSLTSYKSAVSYASDDDFKIGIKEDENSVNVTVEIDKPSAPPSGSPLQDHFDYSTKYNRARKGNISRRSDMEIPQNTGSIKDDDVMASEIEISSNEYGVNTGTSQESGDASTDRHGGNGSFFVGMIRKGLRDFSKSTQHVDQGKVNVMVNGHPIPDRLVKKAEKTAGPIQPGDYWYDSRAGFWGMM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G547580
TK1151 IDTkA03G547580
OH-1004 IDLXL04_010760
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 47.382
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G547580
LocationChr03:138128055-138131658 (-)
DescriptionSimilar to XLG1: Extra-large guanine nucleotide-binding protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_010760 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006897 endocytosis Biological Process
GO:0006952 defense response Biological Process
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway Biological Process
GO:0009617 response to bacterium Biological Process
GO:0009620 response to fungus Biological Process
GO:0009863 salicylic acid mediated signaling pathway Biological Process
GO:0030100 regulation of endocytosis Biological Process
GO:0034052 positive regulation of plant-type hypersensitive response Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0050832 defense response to fungus Biological Process
GO:1900150 regulation of defense response to fungus Biological Process
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT2G23460
ath:AT4G34390
ath:AT5G05190
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.336
Rank 1 · TkA03G547580 · TK1151
Cell membrane0.313
Rank 2 · TkA03G547580 · TK1151
Nucleus0.287
Rank 3 · TkA03G547580 · TK1151
Endoplasmic reticulum0.118
Rank 4 · TkA03G547580 · TK1151
Golgi apparatus0.104
Rank 5 · TkA03G547580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser