Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1647 bp · TkA03G545210|TK1151|cDNA
CGGCGAGCGAGTGTCACTAGGTCATGTTTCCATCCGTACTTGGAAACGGCTTCTAGATTGACCAAAACCTCTCTTTCTCCCCCGATCGGCCCGATCGCCCTATCCTTCAACCTTCGCTTGACACACACACAGCCATGGCGTTTCCCTACATGGAAGCCGTAGTCGGATTCATGATATTGATGTACATCTTTGAGACTTACCTAGATGTGCGACAACATGTTGCTCTCAAGTTGCCAACACTTCCTAAAACTTTGGAAGGA...
867 bp · TkA03G545210|TK1151|CDS
ATGGTTTCAACAAGCAAACCTCTCTTGCTTTACTTTCGTGACATGATTAAAGGCATGATATTGGCTGTAGTAATTGGTCCACCTGTTGTGGCTGCCATCATTCTAATAGTACAGAAAGGTGGTCCCTACTTGGCAATCTATCTTTGGGGGTTTATGTTTGTGTTATCTCTTGTCATGATGACAATTTACCCTGTTCTAATTGCACCCCTTTTTAACAAATTCACACCCCTGCCAGATGGCGTGCTTAGAACAAAGATTGA...
Protein
Download Protein FASTA288 aa · TkA03G545210|TK1151|PROTEIN
MVSTSKPLLLYFRDMIKGMILAVVIGPPVVAAIILIVQKGGPYLAIYLWGFMFVLSLVMMTIYPVLIAPLFNKFTPLPDGVLRTKIENLASSLNFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNEEEVVAVIAHELGHWKLNHTMYSFVAVQVLTLLQFGGYTLVKNSKDLFLSFGFDTQPVLIGLILFQHTIIPIQHLVSFGLNLVSRAFEFQADAFAKKLGYSKPLRDGLVKLQEENLSAMNMDP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G545210 |
|---|---|
| TK1151 ID | TkA03G545210 |
| OH-1004 ID | LXL04_010725 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 97.800 |
| Protein coverage (%) | TK1151 95.139 / OH-1004 42.812Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G545210 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:137536706-137540159 (+) | ||||||||||||
| Description | Similar to FACE1: CAAX prenyl protease 1 homolog | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006281 DNA repair Biological Process GO:0006325 chromatin organization Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006508 proteolysis Biological Process GO:0006629 lipid metabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0006997 nucleus organization Biological Process GO:0006998 nuclear envelope organization Biological Process GO:0007346 regulation of mitotic cell cycle Biological Process GO:0008016 regulation of heart contraction Biological Process GO:0008340 determination of adult lifespan Biological Process GO:0008360 regulation of cell shape Biological Process | ||||||||||||
| KEGG gene cross-reference | ath:AT4G01320 dosa:Os02g0680400 hsa:10269 mmu:230709 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16491Peptidase_M48_N8-73 aaPF05569Peptidase_M5619-65 aaPF15061MITRAC7_Phoenixin54-73 aaPF01435Peptidase_M4877-281 aaPF10263SprT-like114-154 aaPF05569Peptidase_M56115-169 aaPF01433Peptidase_M1120-151 aaPF16491Peptidase_M48_N152-184 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G545210 | PF16491 | Peptidase_M48_N | 8 | 73 | 4.2e-21 | 76.3 |
| TkA03G545210 | PF05569 | Peptidase_M56 | 19 | 65 | 2.0 | 8.2 |
| TkA03G545210 | PF15061 | MITRAC7_Phoenixin | 54 | 73 | 0.081 | 13.3 |
| TkA03G545210 | PF01435 | Peptidase_M48 | 77 | 281 | 1.6e-48 | 165.7 |
| TkA03G545210 | PF10263 | SprT-like | 114 | 154 | 0.1 | 13.2 |
| TkA03G545210 | PF05569 | Peptidase_M56 | 115 | 169 | 2.0 | 8.2 |
| TkA03G545210 | PF01433 | Peptidase_M1 | 120 | 151 | 0.021 | 15.2 |
| TkA03G545210 | PF16491 | Peptidase_M48_N | 152 | 184 | 4.2e-21 | 76.3 |
| TkA03G545210 | PF01433 | Peptidase_M1 | 217 | 243 | 0.021 | 15.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.