RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G543190
Reference: TK1151 Chr: Chr03 Coordinates: 136958266-136961424 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2307 bp · TkA03G543190|TK1151|cDNA

CTTGTAAGATGATTAAATTTGGTATGATAAATTATAAGTATTAACATTGATTTCCCTAAGATCACATGAAGATGCAAATATGGACATTTGCTTAAGAAACGCTTCTCCGACGTCCTCTCTCCCACTGTCTCCCCTTTCACACTCACCTCACACACTGAATCTACTCACAAATCTATGATCAGATCTTGATTCTACACTTCCCAATCTCCAACCTCTACTCTTCACAATCCTCTCAAAATCAATGGGGCATATCAATCTCA...

CDS

Download CDS FASTA

1809 bp · TkA03G543190|TK1151|CDS

ATGGGGCATATCAATCTCACTTCACCCAAGCAACGCAACAATCCCACCCGAAAATGGCAACTTCTCGACTTCGTATCCATGGTATTCTTCGCCATCGTTGTCCTGTTCTTTCTCCTCATATTCACTCCTCTTGGCGACTCTCTTGCGGCTTCTGGGAGCCAAGCTTTGATCCGGTCCAGTACCGCCGATCCGAAGCAACGCCACCGACTCATTGCTCTGGTTGAAGCCGGCAAACATCCGGAGATTGAATCATGCCCTGC...

Protein

Download Protein FASTA

602 aa · TkA03G543190|TK1151|PROTEIN

MGHINLTSPKQRNNPTRKWQLLDFVSMVFFAIVVLFFLLIFTPLGDSLAASGSQALIRSSTADPKQRHRLIALVEAGKHPEIESCPADTVDYMPCEDPTRNSQLSREMNFYRERHCPSPDETPLCLIPAPQGYHVPIQWPESLHKIWHENMPYNKIADRKGHQGWMKKDGPYFIFPGGGTMFPDGATQYIAKLKQYIPISGGTLRTALDMGCGVASFGGHLLEEGILTLSFAPRDSHKSQIQFALERGIPSFVLMLGTRR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G543190
TK1151 IDTkA03G543190
OH-1004 IDLXL04_010683
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)94.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G543190
LocationChr03:136958266-136961424 (+)
DescriptionSimilar to At4g00740: Probable methyltransferase PMT13
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g00740 S-adenosyl-L-methionine (SAM)-dependent methyltransferase (MTase) which mediates the methylesterification of the pectin homogalacturonan (HG) and thus regulates cell wall biosynthesis, at least in suspension-cultured cells.
QUASIMODO 3 (QUA3) is a putative homogalacturonan methyltransferase regulating cell wall biosynthesis in Arabidopsis suspension-cultured cells.2011 · DOI: 10.1093/jxb/err211
At1g33170 Probable methyltransferase PMT18. No verified direct reference in this release
At4g00750 Probable methyltransferase PMT15. No verified direct reference in this release
At4g10440 Probable methyltransferase PMT17. No verified direct reference in this release
At1g26850 Probable methyltransferase PMT2. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_010683 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0032259 methylation Biological Process
GO:0042546 cell wall biogenesis Biological Process
GO:0045489 pectin biosynthetic process Biological Process
GO:0052546 cell wall pectin metabolic process Biological Process
GO:0000138 Golgi trans cisterna Cellular Component
GO:0000139 Golgi membrane Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005768 endosome Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
GO:0005794 Golgi apparatus Cellular Component
KEGG gene cross-reference
ath:AT1G26850
ath:AT1G33170
ath:AT4G00740
ath:AT4G00750
ath:AT4G10440
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.789
Rank 1 · TkA03G543190 · TK1151
Endoplasmic reticulum0.076
Rank 2 · TkA03G543190 · TK1151
Cell membrane0.066
Rank 3 · TkA03G543190 · TK1151
Extracellular0.063
Rank 4 · TkA03G543190 · TK1151
Cytoplasm0.039
Rank 5 · TkA03G543190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141Methyltransf_2991-591 aa
PF13489Methyltransf_23201-319 aa
PF13847Methyltransf_31206-319 aa
PF08241Methyltransf_11208-303 aa
PF13649Methyltransf_25208-299 aa
PF08242Methyltransf_12208-301 aa
PF20922Anamorsin_N263-312 aa
PF13489Methyltransf_23502-553 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G543190PF03141Methyltransf_29915913.8e-206686.3
TkA03G543190PF13489Methyltransf_232013197.2e-0523.3
TkA03G543190PF13847Methyltransf_312063191.6e-0628.7
TkA03G543190PF08241Methyltransf_112083036.7e-1040.2
TkA03G543190PF13649Methyltransf_252082994.8e-0627.9
TkA03G543190PF08242Methyltransf_122083010.01117.2
TkA03G543190PF20922Anamorsin_N2633120.009116.4
TkA03G543190PF13489Methyltransf_235025537.2e-0523.3
TkA03G543190PF13847Methyltransf_315265541.6e-0628.7
TkA03G543190PF08242Methyltransf_125305470.01117.2
TkA03G543190PF08241Methyltransf_115315506.7e-1040.2
TkA03G543190PF13649Methyltransf_255325464.8e-0627.9
TkA03G543190PF20922Anamorsin_N5335520.009116.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q93W95Arabidopsis thalianasp|Q93W95|PMTD_ARATH Probable pectin methyltransferase QUA373.900%Swiss-ProtHigh
Q9C884Arabidopsis thalianasp|Q9C884|PMTI_ARATH Probable methyltransferase PMT1843.900%Swiss-ProtMedium
Q9ZPH9Arabidopsis thalianasp|Q9ZPH9|PMTF_ARATH Probable methyltransferase PMT1544.100%Swiss-ProtMedium
Q9SZX8Arabidopsis thalianasp|Q9SZX8|PMTH_ARATH Probable methyltransferase PMT1744.000%Swiss-ProtMedium
B9DFI7Arabidopsis thalianasp|B9DFI7|PMT2_ARATH Probable methyltransferase PMT243.300%Swiss-ProtMedium

JBrowse

View in Genome Browser