TkA03G542820 | RubberDandelionOmics

Gene overview

TkA03G542820

Reference: TK1151 Chr: Chr03 Coordinates: 136865868-136869599 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2151 bp · TkA03G542820|TK1151|cDNA

ACGTGTCCTGATCTAAGTGCCACTGTTTATAATGGACACGCAAAGGTTATTTAATGGACTAGATTGCTCCATCTTTGATTGACTTAAGTGAAGTATCTATATGAAATCCCCCAAAAGTGGATTGAATTCTCTTCATGCTAATGGACTAATGGTATCCATGGAGTTTAAAAGCACCCGATACACGCACAGCCACAAAAATCTTTAGAGCTCTCCTAATCCCTCACGTTTTTGCCGTAATTTTTGACTGCAAAAACCCAACA...

CDS

Download CDS FASTA

891 bp · TkA03G542820|TK1151|CDS

ATGCTTATTTCATTTCAACATGGCGCATTTATACCTGGTTATCCGATTCAACCAGTTATTGTTCGTTATCCTCATGTACATTTTGATCAATCATGGGGTCATATTGCTTTGGCGACACTCATGTTTAGGATGTTCACACAGTTTCATAATTTCATGGAGATTGAATATCTTCCAGTTATTTCACCATCTGAACATTATAAGGAAAGTGCTGTTCGTTTTGCTGAGAAAACAGGTAGATCCATGGCTCGTGCTCTGAATGT...

Protein

Download Protein FASTA

296 aa · TkA03G542820|TK1151|PROTEIN

MLISFQHGAFIPGYPIQPVIVRYPHVHFDQSWGHIALATLMFRMFTQFHNFMEIEYLPVISPSEHYKESAVRFAEKTGRSMARALNVVQTSHSFLDYLLLSKAADSGHENPSLFVVEMAKIQQLFPLSSSDALDLLDRFLAMNPDPSGNVKIQDFLRVLRLKHCGLSQKMFDFIDVGKNGEIIFKEFLVGSAHILNQPLFQQACELAFTETDIDQDLHIDEQQLGASLMPAMGSLSTDEIGGLFSLFDGDNDGRISKGDF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G542820`
TK1151 ID	TkA03G542820
OH-1004 ID	LXL04_010678
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 53.623 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G542820

Location Chr03:136865868-136869599 (-)

Description Similar to LPEAT2: Lysophospholipid acyltransferase LPEAT2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45670`	Possesses acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates.	Characterization of two Arabidopsis thaliana acyltransferases with preference for lysophosphatidylethanolamine.2009 · DOI: 10.1186/1471-2229-9-60 Acyl-CoA:Lysophosphatidylethanolamine Acyltransferase Activity Regulates Growth of Arabidopsis.2017 · DOI: 10.1104/pp.17.00391

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010678 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0006644 phospholipid metabolic process Biological Process

GO:0006654 phosphatidic acid biosynthetic process Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0030258 lipid modification Biological Process

GO:0036148 phosphatidylglycerol acyl-chain remodeling Biological Process

GO:0036151 phosphatidylcholine acyl-chain remodeling Biological Process

GO:0043129 surfactant homeostasis Biological Process

GO:0045732 positive regulation of protein catabolic process Biological Process

GO:2001246 negative regulation of phosphatidylcholine biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT2G45670

dme:Dmel_CG32699

hsa:79888

mmu:210992

rno:361467

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.410

Rank 1 · TkA03G542820 · TK1151

Mitochondrion0.217

Rank 2 · TkA03G542820 · TK1151

Nucleus0.196

Rank 3 · TkA03G542820 · TK1151

Endoplasmic reticulum0.174

Rank 4 · TkA03G542820 · TK1151

Cell membrane0.152

Rank 5 · TkA03G542820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23564EF-hand_FSTL1134-161 aa

PF13405EF-hand_6135-160 aa

PF13499EF-hand_7135-188 aa

PF14658EF-hand_9140-161 aa

PF00036EF-hand_1147-160 aa

PF12763EH151-190 aa

PF00036EF-hand_1168-188 aa

PF13833EF-hand_8168-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G542820	`PF23564`	EF-hand_FSTL1	134	161	0.026	15.6
TkA03G542820	`PF13405`	EF-hand_6	135	160	4.6e-10	39.0
TkA03G542820	`PF13499`	EF-hand_7	135	188	5.2e-09	37.0
TkA03G542820	`PF14658`	EF-hand_9	140	161	0.23	12.6
TkA03G542820	`PF00036`	EF-hand_1	147	160	1.5e-08	34.3
TkA03G542820	`PF12763`	EH	151	190	0.038	14.6
TkA03G542820	`PF00036`	EF-hand_1	168	188	1.5e-08	34.3
TkA03G542820	`PF13833`	EF-hand_8	168	189	2.4e-06	27.9
TkA03G542820	`PF23564`	EF-hand_FSTL1	168	188	0.026	15.6
TkA03G542820	`PF13405`	EF-hand_6	169	188	4.6e-10	39.0
TkA03G542820	`PF13202`	EF-hand_5	169	186	0.0098	16.1
TkA03G542820	`PF14658`	EF-hand_9	170	186	0.23	12.6
TkA03G542820	`PF13499`	EF-hand_7	204	262	5.2e-09	37.0
TkA03G542820	`PF13833`	EF-hand_8	204	216	2.4e-06	27.9
TkA03G542820	`PF00036`	EF-hand_1	206	225	1.5e-08	34.3
TkA03G542820	`PF13405`	EF-hand_6	207	229	4.6e-10	39.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S8S2`	Arabidopsis thaliana	sp\|Q8S8S2\|LPCT2_ARATH Lysophospholipid acyltransferase LPEAT2	60.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card