RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G535840
Reference: TK1151 Chr: Chr03 Coordinates: 134844065-134853382 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

5661 bp · TkA03G535840|TK1151|cDNA

TTTTCCTTTCCTTTTCGCTAACTGGTGTCTTCGTTTTTAGTAAAACTTGATCCACCATCGACAACAAGATCTCAGAGCGCGAGAGCTTGATCTCTCTCACTCGCGAGTTCAACTCAACTCATTGCTCTTCTATTCCAACTTAAACCGAGATCTGTGGCTTTAATACGATCAAAGCAAGAAGATCGATTCAGAATTGGAAGTCTTTCATAAGAAAAAATTTAAATCGAAGATGGCCGGAGGTGCTGCAGGAGGTTTTGTTA...

CDS

Download CDS FASTA

5130 bp · TkA03G535840|TK1151|CDS

ATGGCCGGAGGTGCTGCAGGAGGTTTTGTTACTCGAGCATTGGAATCCATGCTCAAAGAGTGTTCTGGGAAGAAGTACACCTCTCTTCAGACTGCAATCCAATCTTATCTAGAAAATTCCAAAGAGATCAATAAAGAGGTGAAATCAAGTGATGCCAACAAAGTTACATCTTCAGAGGGAGGAGATACAAGTGTGCCCGAAACCAACAACGATGGAACTGCAAAAACTGAAGAGGAGGCTGATGTGGCACCTTCAGCTTC...

Protein

Download Protein FASTA

1709 aa · TkA03G535840|TK1151|PROTEIN

MAGGAAGGFVTRALESMLKECSGKKYTSLQTAIQSYLENSKEINKEVKSSDANKVTSSEGGDTSVPETNNDGTAKTEEEADVAPSASQDAEVAEPVSARVASSGSVKTTLASAGHSLEGAESELVLSPLRLAFETKNPKVLELALDCLHKLIAYDHLEGDPGLENGKNGPLFTEILTMVCSCVDNSSPDSTTLQVLKVLLTAVASAKFRVHGEALLGVIRVCYNIALNSKSPINQATSKAMLTQMINIVFRRMETDLMSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G535840
TK1151 IDTkA03G535840
OH-1004 IDLXL04_010570
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.600
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G535840
LocationChr03:134844065-134853382 (+)
DescriptionSimilar to BIG5: Brefeldin A-inhibited guanine nucleotide-exchange protein 5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g43300 Activates the ARF proteins by exchanging bound GDP for free GTP.
Effector-triggered immunity blocks pathogen degradation of an immunity-associated vesicle traffic regulator in Arabidopsis.2011 · DOI: 10.1073/pnas.1103338108
At3g60860 Activates the ARF proteins by exchanging bound GDP for free GTP. No verified direct reference in this release
At1g01960 Activates the ARF proteins by exchanging bound GDP for free GTP. No verified direct reference in this release
At4g38200 Activates the ARF proteins by exchanging bound GDP for free GTP. No verified direct reference in this release
At4g35380 Activates the ARF proteins by exchanging bound GDP for free GTP. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_010570 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006886 intracellular protein transport Biological Process
GO:0006897 endocytosis Biological Process
GO:0006955 immune response Biological Process
GO:0009561 megagametogenesis Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0015031 protein transport Biological Process
GO:0016192 vesicle-mediated transport Biological Process
GO:0031338 regulation of vesicle fusion Biological Process
GO:0032012 regulation of ARF protein signal transduction Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0043001 Golgi to plasma membrane protein transport Biological Process
GO:0045087 innate immune response Biological Process
KEGG gene cross-reference
ath:AT1G01960
ath:AT3G43300
ath:AT3G60860
ath:AT4G38200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.420
Rank 1 · TkA03G535840 · TK1151
Golgi apparatus0.403
Rank 2 · TkA03G535840 · TK1151
Cell membrane0.214
Rank 3 · TkA03G535840 · TK1151
Nucleus0.134
Rank 4 · TkA03G535840 · TK1151
Endoplasmic reticulum0.127
Rank 5 · TkA03G535840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21398PG_binding_535-72 aa
PF16213DCB115-256 aa
PF12783Sec7-like_HUS122-153 aa
PF09324Sec7-like_HDS125-153 aa
PF10274ParcG126-156 aa
PF02985HEAT131-152 aa
PF23325TPR_28172-207 aa
PF24573HEAT_DAAF5176-204 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G535840PF21398PG_binding_535720.02415.3
TkA03G535840PF16213DCB1152569.4e-31107.6
TkA03G535840PF12783Sec7-like_HUS1221531.6e-39136.0
TkA03G535840PF09324Sec7-like_HDS1251537.4e-31106.6
TkA03G535840PF10274ParcG1261560.2412.3
TkA03G535840PF02985HEAT1311520.07414.1
TkA03G535840PF23325TPR_281722071.3e-0835.6
TkA03G535840PF24573HEAT_DAAF51762040.03414.5
TkA03G535840PF12783Sec7-like_HUS1912471.6e-39136.0
TkA03G535840PF10274ParcG1912550.2412.3
TkA03G535840PF12783Sec7-like_HUS3304811.6e-39136.0
TkA03G535840PF24573HEAT_DAAF53353760.03414.5
TkA03G535840PF20252BIG2_C5165411.4e-2384.6
TkA03G535840PF28972TEX505185870.1512.4
TkA03G535840PF01369Sec75737543.2e-71239.5
TkA03G535840PF21398PG_binding_58828980.02415.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4IXW2Arabidopsis thalianasp|F4IXW2|BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 569.600%Swiss-ProtHigh
Q9LZX8Arabidopsis thalianasp|Q9LZX8|BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 234.200%Swiss-ProtMedium
Q9LPC5Arabidopsis thalianasp|Q9LPC5|BIG3_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 334.000%Swiss-ProtMedium
F4JSZ5Arabidopsis thalianasp|F4JSZ5|BIG1_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 133.300%Swiss-ProtMedium
F4JN05Arabidopsis thalianasp|F4JN05|BIG4_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 436.100%Swiss-ProtMedium

JBrowse

View in Genome Browser