TkA03G535790 | RubberDandelionOmics

Gene overview

TkA03G535790

Reference: TK1151 Chr: Chr03 Coordinates: 134818077-134818400 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · TkA03G535790|TK1151|cDNA

ATGTTCCCATGGCTAGCCATGGGCCATCTGATACCTTTCTTGCACTTTTCAAAAATCTTAGCTCAAAAAGGCCATAAAATCTCATACATTTCCACTCCAAGAAATCTAAGTAGAATCCCCAAAATACACCCAAAAACTATCCCACAACATCAAACTAGTAGCCCTTCCGTTTCCCAAAGTGGAAGGTTTGCCGGAACATGTGGAGTCTTCCATGGACATACCTCACCAAAAATCCCAGTTTCTAAAAATAGCATTCGATC...

CDS

Download CDS FASTA

324 bp · TkA03G535790|TK1151|CDS

ATGTTCCCATGGCTAGCCATGGGCCATCTGATACCTTTCTTGCACTTTTCAAAAATCTTAGCTCAAAAAGGCCATAAAATCTCATACATTTCCACTCCAAGAAATCTAAGTAGAATCCCCAAAATACACCCAAAAACTATCCCACAACATCAAACTAGTAGCCCTTCCGTTTCCCAAAGTGGAAGGTTTGCCGGAACATGTGGAGTCTTCCATGGACATACCTCACCAAAAATCCCAGTTTCTAAAAATAGCATTCGATC...

Protein

Download Protein FASTA

107 aa · TkA03G535790|TK1151|PROTEIN

MFPWLAMGHLIPFLHFSKILAQKGHKISYISTPRNLSRIPKIHPKTIPQHQTSSPSVSQSGRFAGTCGVFHGHTSPKIPVSKNSIRSARVLWSTFLKNTNQARLDYL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G535790`
TK1151 ID	TkA03G535790
OH-1004 ID	LXL04_014018
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.300
Protein coverage (%)	TK1151 39.252 / OH-1004 4.357 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G535790

Location Chr03:134818077-134818400 (+)

Description Similar to UGT91D1: UDP-glycosyltransferase 91D1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49690`	UDP-glycosyltransferase 91C1.	No verified direct reference in this release
`At2g22590`	UDP-glycosyltransferase 91A1.	No verified direct reference in this release
`At5g65550`	UDP-glycosyltransferase 91B1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014018 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016020 membrane Cellular Component

GO:0035251 UDP-glucosyltransferase activity Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.385

Rank 1 · TkA03G535790 · TK1151

Nucleus0.221

Rank 2 · TkA03G535790 · TK1151

Extracellular0.121

Rank 3 · TkA03G535790 · TK1151

Mitochondrion0.115

Rank 4 · TkA03G535790 · TK1151

Endoplasmic reticulum0.091

Rank 5 · TkA03G535790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168Glyco_transf_N2-36 aa

PF03033Glyco_transf_288-38 aa

PF26168Glyco_transf_N43-70 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G535790	`PF26168`	Glyco_transf_N	2	36	0.02	15.5
TkA03G535790	`PF03033`	Glyco_transf_28	8	38	0.012	16.4
TkA03G535790	`PF26168`	Glyco_transf_N	43	70	0.02	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTA3`	Arabidopsis thaliana	sp\|Q9LTA3\|U91C1_ARATH UDP-glycosyltransferase 91C1	78.600%	Swiss-Prot	Low
`Q940V3`	Arabidopsis thaliana	sp\|Q940V3\|U91A1_ARATH UDP-glycosyltransferase 91A1	66.700%	Swiss-Prot	Low
`Q9LSM0`	Arabidopsis thaliana	sp\|Q9LSM0\|U91B1_ARATH UDP-glycosyltransferase 91B1	63.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card