TkA03G530450 | RubberDandelionOmics

Gene overview

TkA03G530450

Reference: TK1151 Chr: Chr03 Coordinates: 133375998-133377475 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1121 bp · TkA03G530450|TK1151|cDNA

CAAATATCACAAACTCTCTTCAATATTCTCCTCCTCATCATCATCTTGTTCTTCCTCTCTTACTTGGCAAAATCCCAAATCTTCATCTACTATGCATGTTCTGAAGAAAAATTCCAACCAAACACCCCTTCCGAAACCAATCTCAACTCTTTACTTTCATTATTTGTTTCTTCATCCTCCCAAGCCTTATACAAAAGTTTCGCCATTGGAAACGACACAAACGCGTCTTCAGAATCTTCTGTATATGGTTTGTACCAATG...

CDS

Download CDS FASTA

831 bp · TkA03G530450|TK1151|CDS

CAAATATCACAAACTCTCTTCAATATTCTCCTCCTCATCATCATCTTGTTCTTCCTCTCTTACTTGGCAAAATCCCAAATCTTCATCTACTATGCATGTTCTGAAGAAAAATTCCAACCAAACACCCCTTCCGAAACCAATCTCAACTCTTTACTTTCATTATTTGTTTCTTCATCCTCCCAAGCCTTATACAAAAGTTTCGCCATTGGAAACGACACAAACGCGTCTTCAGAATCTTCTGTATATGGTTTGTACCAATG...

Protein

Download Protein FASTA

276 aa · TkA03G530450|TK1151|PROTEIN

QISQTLFNILLLIIILFFLSYLAKSQIFIYYACSEEKFQPNTPSETNLNSLLSLFVSSSSQALYKSFAIGNDTNASSESSVYGLYQCRGDLRTQECTKCVKKAVSEVGLACPNSYSGGLELDECSVRFDHFDFLGELDTSIRFKKCSKSASHDGEFIRRRDDVLSELGEANYQGFRVGSEGLVQGFSQCLGDLNQDDCGTCLGEAISKLKSLCGSSEAGDVFLAQCYVRYWASGYYNSPAKSSGGDDDIGKTIAIVIGVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G530450`
TK1151 ID	TkA03G530450
OH-1004 ID	LXL04_010486
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 91.667 / OH-1004 85.763 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G530450

Location Chr03:133375998-133377475 (+)

Description Similar to PDLP8: Plasmodesmata-located protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60720`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At2g01660`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At1g70690`	Modulates cell-to-cell trafficking.	A plasmodesmata-localized protein mediates crosstalk between cell-to-cell communication and innate immunity in Arabidopsis.2011 · DOI: 10.1105/tpc.111.087742
`At2g33330`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At1g61750`	Cysteine-rich repeat secretory protein 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010486 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009615 response to virus Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0046739 transport of virus in multicellular host Biological Process

GO:0051707 response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0001872 (1->3)-beta-D-glucan binding Molecular Function

KEGG gene cross-reference

ath:AT1G70690

ath:AT2G01660

ath:AT2G33330

ath:AT3G60720

ath:AT5G37660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.706

Rank 1 · TkA03G530450 · TK1151

Extracellular0.123

Rank 2 · TkA03G530450 · TK1151

Endoplasmic reticulum0.101

Rank 3 · TkA03G530450 · TK1151

Cytoplasm0.074

Rank 4 · TkA03G530450 · TK1151

Lysosome / Vacuole0.040

Rank 5 · TkA03G530450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520Ion_trans3-59 aa

PF01102Glycophorin_A12-22 aa

PF01657Stress-antifung33-129 aa

PF01657Stress-antifung146-230 aa

PF01102Glycophorin_A253-273 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G530450	`PF00520`	Ion_trans	3	59	0.013	15.4
TkA03G530450	`PF01102`	Glycophorin_A	12	22	0.17	12.8
TkA03G530450	`PF01657`	Stress-antifung	33	129	1.4e-28	100.1
TkA03G530450	`PF01657`	Stress-antifung	146	230	1.4e-28	100.1
TkA03G530450	`PF01102`	Glycophorin_A	253	273	0.17	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NKQ9`	Arabidopsis thaliana	sp\|Q6NKQ9\|PDLP8_ARATH Plasmodesmata-located protein 8	51.800%	Swiss-Prot	High
`Q9ZU94`	Arabidopsis thaliana	sp\|Q9ZU94\|PDLP6_ARATH Plasmodesmata-located protein 6	42.800%	Swiss-Prot	Medium
`Q8GUJ2`	Arabidopsis thaliana	sp\|Q8GUJ2\|PDLP5_ARATH Plasmodesmata-located protein 5	39.200%	Swiss-Prot	Medium
`O22784`	Arabidopsis thaliana	sp\|O22784\|PDLP3_ARATH Plasmodesmata-located protein 3	27.400%	Swiss-Prot	Low
`Q9SYB1`	Arabidopsis thaliana	sp\|Q9SYB1\|CRRS1_ARATH Cysteine-rich repeat secretory protein 1	27.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card