TkA03G528560 | RubberDandelionOmics

Gene overview

TkA03G528560

Reference: TK1151 Chr: Chr03 Coordinates: 132850297-132855793 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1215 bp · TkA03G528560|TK1151|cDNA

GACAAACTCACCCCCAATTCTAATCAAATGGAATTTCAGAAACTAATATCCGTTGGATTCTTGTTATCAACCCTAATAATCACCGGAGTGTTTGCCGATTGCACTTGTGAACCAGAAATAAACCCCGGTGAAAAAAACAAAGCTCTCCGGTACAAACTGATAGCACTTGCTTCCATTCTAATCTCCGGCTGTATAGGCATTTCTCTACCTTTCGCCGGAAAGATTTTCCCGGCTTTACGTCCTGAAAAAGACGGTTTCTT...

CDS

Download CDS FASTA

1044 bp · TkA03G528560|TK1151|CDS

ATGGAATTTCAGAAACTAATATCCGTTGGATTCTTGTTATCAACCCTAATAATCACCGGAGTGTTTGCCGATTGCACTTGTGAACCAGAAATAAACCCCGGTGAAAAAAACAAAGCTCTCCGGTACAAACTGATAGCACTTGCTTCCATTCTAATCTCCGGCTGTATAGGCATTTCTCTACCTTTCGCCGGAAAGATTTTCCCGGCTTTACGTCCTGAAAAAGACGGTTTCTTCCTGGTGAAAGCATTCGCCGCCGGTGT...

Protein

Download Protein FASTA

347 aa · TkA03G528560|TK1151|PROTEIN

MEFQKLISVGFLLSTLIITGVFADCTCEPEINPGEKNKALRYKLIALASILISGCIGISLPFAGKIFPALRPEKDGFFLVKAFAAGVILATGFIHILPHAFDSLTSPCLKDHPWADFPFTGFMAMVATIATLLFETLSAAYQVRAQTAAAAKVVGEGEDEENNDEMHVSHGHGHVHGSVLPTADDSDVNRYRIVSQVLELGIIIHSVIIGLSLGASHNPKTIKPLIAALSFHQFFEGVGLGGCLFQAKIKSLATTFMGVC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G528560`
TK1151 ID	TkA03G528560
OH-1004 ID	LXL04_010457
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G528560

Location Chr03:132850297-132855793 (+)

Description Similar to ZIP5: Zinc transporter 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32270`	Mediates zinc uptake from the rhizosphere.	No verified direct reference in this release
`At1g05300`	Probably mediates zinc uptake from the rhizosphere.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0472700`	Zinc transporter that mediates zinc uptake from the rhizosphere and may be responsible for the translocation of zinc within the plant.	OsZIP5 is a plasma membrane zinc transporter in rice.2010 · DOI: 10.1007/s11103-010-9637-0
`Os05g0472400`	Zinc transporter that may be involved in zinc uptake from the rhizosphere.	No verified direct reference in this release
`Os04g0613000`	Zinc transporter that may mediate zinc uptake from the rhizosphere.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010457 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006829 zinc ion transport Biological Process

GO:0071577 zinc ion transmembrane transport Biological Process

GO:1990359 stress response to zinc ion Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005385 zinc ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G05300

ath:AT2G32270

ath:AT3G12750

dosa:Os04g0613000

dosa:Os05g0472700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.746

Rank 1 · TkA03G528560 · TK1151

Endoplasmic reticulum0.103

Rank 2 · TkA03G528560 · TK1151

Lysosome / Vacuole0.084

Rank 3 · TkA03G528560 · TK1151

Cytoplasm0.065

Rank 4 · TkA03G528560 · TK1151

Golgi apparatus0.034

Rank 5 · TkA03G528560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30649ABC1_C9-19 aa

PF30649ABC1_C39-60 aa

PF02535Zip41-344 aa

PF30649ABC1_C116-133 aa

PF18186SLATT_4119-152 aa

PF30649ABC1_C195-230 aa

PF18186SLATT_4267-335 aa

PF30649ABC1_C291-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G528560	`PF30649`	ABC1_C	9	19	0.21	12.0
TkA03G528560	`PF30649`	ABC1_C	39	60	0.21	12.0
TkA03G528560	`PF02535`	Zip	41	344	7.7e-74	249.5
TkA03G528560	`PF30649`	ABC1_C	116	133	0.21	12.0
TkA03G528560	`PF18186`	SLATT_4	119	152	0.16	12.3
TkA03G528560	`PF30649`	ABC1_C	195	230	0.21	12.0
TkA03G528560	`PF18186`	SLATT_4	267	335	0.16	12.3
TkA03G528560	`PF30649`	ABC1_C	291	301	0.21	12.0
TkA03G528560	`PF30649`	ABC1_C	326	340	0.21	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLG3`	Arabidopsis thaliana	sp\|Q9SLG3\|ZIP3_ARATH Zinc transporter 3	49.000%	Swiss-Prot	Medium
`O23039`	Arabidopsis thaliana	sp\|O23039\|ZIP5_ARATH Zinc transporter 5	53.500%	Swiss-Prot	High
`Q6L8G0`	Oryza sativa subsp. japonica	sp\|Q6L8G0\|ZIP5_ORYSJ Zinc transporter 5	50.200%	Swiss-Prot	High
`Q0DHE3`	Oryza sativa subsp. japonica	sp\|Q0DHE3\|ZIP9_ORYSJ Zinc transporter 9	48.200%	Swiss-Prot	Medium
`Q7XLD4`	Oryza sativa subsp. japonica	sp\|Q7XLD4\|ZIP3_ORYSJ Zinc transporter 3	49.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card