TkA03G527920 | RubberDandelionOmics

Gene overview

TkA03G527920

Reference: TK1151 Chr: Chr03 Coordinates: 132681932-132682552 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

453 bp · TkA03G527920|TK1151|cDNA

CAGGCCCCACCATCAAAAACTCAGGATACGATCTCATTTATCGTTAATACTTTATCGGATGCCAATACTGAAGCTAAAGTAAAAGAGTTTACAAAGATTTTGGAAGAACAATACTATCCCTGGTTTGCACAGTATATCGTTATGAATAGAGTGAGCACTGAACCAAACTTTCACATGTTGTATATAAATTTCCTTGAGAAAGCTAATTCAAAACAGCTTATGGGAGAAATACTCCGAGAAACTTATGAGAATTGCAAGGT...

CDS

Download CDS FASTA

453 bp · TkA03G527920|TK1151|CDS

CAGGCCCCACCATCAAAAACTCAGGATACGATCTCATTTATCGTTAATACTTTATCGGATGCCAATACTGAAGCTAAAGTAAAAGAGTTTACAAAGATTTTGGAAGAACAATACTATCCCTGGTTTGCACAGTATATCGTTATGAATAGAGTGAGCACTGAACCAAACTTTCACATGTTGTATATAAATTTCCTTGAGAAAGCTAATTCAAAACAGCTTATGGGAGAAATACTCCGAGAAACTTATGAGAATTGCAAGGT...

Protein

Download Protein FASTA

150 aa · TkA03G527920|TK1151|PROTEIN

QAPPSKTQDTISFIVNTLSDANTEAKVKEFTKILEEQYYPWFAQYIVMNRVSTEPNFHMLYINFLEKANSKQLMGEILRETYENCKVLLRSELIQSSTEERALLKNFGGWLGKITIGRNKVLLRKHIDPKSLVIEVGFSFSFHPLKFVCL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G527920`
TK1151 ID	TkA03G527920
OH-1004 ID	LXL04_010452
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 90.667 / OH-1004 7.875 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G527920`
Location	Chr03:132681932-132682552 (+)
Description	Similar to cnot1: CCR4-NOT transcription complex subunit 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010452` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Biological Process GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0010606 positive regulation of cytoplasmic mRNA processing body assembly Biological Process GO:0017148 negative regulation of translation Biological Process GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway Biological Process GO:0035195 miRNA-mediated post-transcriptional gene silencing Biological Process GO:0048387 negative regulation of retinoic acid receptor signaling pathway Biological Process GO:0060213 positive regulation of nuclear-transcribed mRNA poly(A) tail shortening Biological Process GO:0061014 positive regulation of mRNA catabolic process Biological Process
KEGG gene cross-reference	hsa:23019 mmu:234594 xtr:100036630 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.706

Rank 1 · TkA03G527920 · TK1151

Nucleus0.235

Rank 2 · TkA03G527920 · TK1151

Cell membrane0.132

Rank 3 · TkA03G527920 · TK1151

Golgi apparatus0.066

Rank 4 · TkA03G527920 · TK1151

Mitochondrion0.059

Rank 5 · TkA03G527920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16415CNOT1_CAF1_bind2-135 aa

PF09929DUF216122-44 aa

PF09929DUF216191-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G527920	`PF16415`	CNOT1_CAF1_bind	2	135	3.1e-49	168.1
TkA03G527920	`PF09929`	DUF2161	22	44	0.06	14.2
TkA03G527920	`PF09929`	DUF2161	91	117	0.06	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card