TkA03G526990 | RubberDandelionOmics

Gene overview

TkA03G526990

Reference: TK1151 Chr: Chr03 Coordinates: 132276199-132278333 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1567 bp · TkA03G526990|TK1151|cDNA

AAAGGGTGTCGTGGGGACATCATCAAAACGTGGACATCCTACTCCCACTGGCGAAACCGATCCCAATCAATTTCAAGATACAATAATTAAGCTGTGTCAACTCAGAAATGGGGAAGAAGGCGGTGTTGATCGGCTGCAACTACGCCGGAACCAAGGCGGAGCTCAGGGGATGCATCAACGATGTCAAGAGAATGTACCGTTGTCTGGTTGACCGTTACGGATTCTCCGAGGACGATATTAAAATCATTATCGATGCAGAC...

CDS

Download CDS FASTA

1269 bp · TkA03G526990|TK1151|CDS

ATGGGGAAGAAGGCGGTGTTGATCGGCTGCAACTACGCCGGAACCAAGGCGGAGCTCAGGGGATGCATCAACGATGTCAAGAGAATGTACCGTTGTCTGGTTGACCGTTACGGATTCTCCGAGGACGATATTAAAATCATTATCGATGCAGACGACTCCTATACCCAGCCTACCGGCCGTAACATCCGCCAAGCGCTCGACGATCTCGTCCAATCGGCTGAGCCTGGTGACTTCCTTGTCGTTCATTACAGCGGTCATGG...

Protein

Download Protein FASTA

422 aa · TkA03G526990|TK1151|PROTEIN

MGKKAVLIGCNYAGTKAELRGCINDVKRMYRCLVDRYGFSEDDIKIIIDADDSYTQPTGRNIRQALDDLVQSAEPGDFLVVHYSGHGTRLPAETGDDDDTGYDECIVPCDFNLITDDDFRDLVDRVPHGCRITIISDSCHSGGLIDEAKEQIGESYKNDPDEEEGSGSGFKLSSFLHKTAESALDSRGIHVPSRFRHKKRDEEDEVEEEEEKELTYEGDLQVKNKSLPLSTLIEILKQKTGKDDVDVGNVRPTLFDIFGD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G526990`
TK1151 ID	TkA03G526990
OH-1004 ID	LXL04_010428
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G526990

Location Chr03:132276199-132278333 (-)

Description Similar to AMC4: Metacaspase-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79340`	Cysteine protease that cleaves specifically after arginine or lysine residues.	Calcium-dependent activation and autolysis of Arabidopsis metacaspase 2d.2011 · DOI: 10.1074/jbc.m110.194340 Arabidopsis metacaspase 2d is a positive mediator of cell death induced during biotic and abiotic stresses.2011 · DOI: 10.1111/j.1365-313x.2011.04554.x
`At1g79330`	Cysteine protease that cleaves specifically after arginine or lysine residues.	Two Arabidopsis metacaspases AtMCP1b and AtMCP2b are arginine/lysine-specific cysteine proteases and activate apoptosis-like cell death in yeast.2005 · DOI: 10.1074/jbc.m413527200
`At1g79320`	Metacaspase-6.	No verified direct reference in this release
`At1g79310`	Metacaspase-7.	No verified direct reference in this release
`At1g16420`	Cysteine protease that cleaves specifically after arginine residues.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010428 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0010225 response to UV-C Biological Process

GO:0010421 hydrogen peroxide-mediated programmed cell death Biological Process

GO:0012501 programmed cell death Biological Process

GO:0016540 protein autoprocessing Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G16420

ath:AT1G79310

ath:AT1G79320

ath:AT1G79330

ath:AT1G79340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.494

Rank 1 · TkA03G526990 · TK1151

Nucleus0.258

Rank 2 · TkA03G526990 · TK1151

Lysosome / Vacuole0.161

Rank 3 · TkA03G526990 · TK1151

Cell membrane0.160

Rank 4 · TkA03G526990 · TK1151

Endoplasmic reticulum0.124

Rank 5 · TkA03G526990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31181Pept_C14_Metacaspase3-146 aa

PF00656Peptidase_C143-412 aa

PF29089Protamine-3200-228 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G526990	`PF31181`	Pept_C14_Metacaspase	3	146	4.1e-44	151.5
TkA03G526990	`PF00656`	Peptidase_C14	3	412	1e-42	147.2
TkA03G526990	`PF29089`	Protamine-3	200	228	0.078	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64517`	Arabidopsis thaliana	sp\|O64517\|MCA4_ARATH Metacaspase-4	63.700%	Swiss-Prot	High
`O64518`	Arabidopsis thaliana	sp\|O64518\|MCA5_ARATH Metacaspase-5	60.800%	Swiss-Prot	High
`O64519`	Arabidopsis thaliana	sp\|O64519\|MCA6_ARATH Metacaspase-6	57.600%	Swiss-Prot	High
`Q6XPT5`	Arabidopsis thaliana	sp\|Q6XPT5\|MCA7_ARATH Metacaspase-7	51.500%	Swiss-Prot	High
`Q9SA41`	Arabidopsis thaliana	sp\|Q9SA41\|MCA8_ARATH Metacaspase-8	39.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card