TkA03G526770 | RubberDandelionOmics

Gene overview

TkA03G526770

Reference: TK1151 Chr: Chr03 Coordinates: 132221439-132223404 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · TkA03G526770|TK1151|cDNA

ATGCCATTCACGAGCATCCGCCCATTTCCACCCACATCATTGCACCACGAGTTTACCACCGCCTTGTCTCCGCCGTGGCAACATCTTCGGGAACCGCCATACATCCCTAAATCACTCACCACTTCTCACTTTACTACAAGGAAACATCGACTTGATGGAACAATGGTGACTAAAAAGAGTGGAATTGGATTCAAAAATTACATTTACATGGAATTGGAGAACAATATTGCAGCCACAACTGATGATCTTATTATTTTTCT...

CDS

Download CDS FASTA

591 bp · TkA03G526770|TK1151|CDS

ATGCCATTCACGAGCATCCGCCCATTTCCACCCACATCATTGCACCACGAGTTTACCACCGCCTTGTCTCCGCCGTGGCAACATCTTCGGGAACCGCCATACATCCCTAAATCACTCACCACTTCTCACTTTACTACAAGGAAACATCGACTTGATGGAACAATGGTGACTAAAAAGAGTGGAATTGGATTCAAAAATTACATTTACATGGAATTGGAGAACAATATTGCAGCCACAACTGATGATCTTATTATTTTTCT...

Protein

Download Protein FASTA

196 aa · TkA03G526770|TK1151|PROTEIN

MPFTSIRPFPPTSLHHEFTTALSPPWQHLREPPYIPKSLTTSHFTTRKHRLDGTMVTKKSGIGFKNYIYMELENNIAATTDDLIIFLIPIGLEECIRFIANFKLSKEDIAFLQECLSPKCEDAFFDYLESIDCSDVEVYAIAEGSIVFPKVPLMRIIVIFQVVQLLETPFVNLINFASLVTTNATDTVFVEKINFF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G526770`
TK1151 ID	TkA03G526770
OH-1004 ID	LXL04_010422
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	79.800
Protein coverage (%)	TK1151 94.388 / OH-1004 90.291 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G526770

Location Chr03:132221439-132223404 (-)

Description Similar to NAPRT2: Nicotinate phosphoribosyltransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23420`	Catalyzes the first step in the biosynthesis of NAD from nicotinic acid, the ATP-dependent synthesis of beta-nicotinate D-ribonucleotide from nicotinate and 5-phospho-D-ribose 1-phosphate.	No verified direct reference in this release
`At4g36940`	Catalyzes the first step in the biosynthesis of NAD from nicotinic acid, the ATP-dependent synthesis of beta-nicotinate D-ribonucleotide from nicotinate and 5-phospho-D-ribose 1-phosphate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010422 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009435 NAD+ biosynthetic process Biological Process

GO:0034355 NAD+ biosynthetic process via the salvage pathway Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004516 nicotinate phosphoribosyltransferase activity Molecular Function

GO:0016740 transferase activity Molecular Function

GO:0016757 glycosyltransferase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G23420

ath:AT4G36940

bta:399559

ddi:DDB_G0268472

rno:315085

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.705

Rank 1 · TkA03G526770 · TK1151

Cytoplasm0.169

Rank 2 · TkA03G526770 · TK1151

Nucleus0.086

Rank 3 · TkA03G526770 · TK1151

Mitochondrion0.083

Rank 4 · TkA03G526770 · TK1151

Peroxisome0.056

Rank 5 · TkA03G526770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17767NAPRTase_N91-175 aa

PF02749QRPTase_N135-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G526770	`PF17767`	NAPRTase_N	91	175	2.8e-16	60.7
TkA03G526770	`PF02749`	QRPTase_N	135	178	0.034	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WV8`	Arabidopsis thaliana	sp\|Q84WV8\|NPRT2_ARATH Nicotinate phosphoribosyltransferase 2	71.300%	Swiss-Prot	Low
`Q8RWM2`	Arabidopsis thaliana	sp\|Q8RWM2\|NPRT1_ARATH Nicotinate phosphoribosyltransferase 1	68.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card