Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1211 bp · TkA03G526110|TK1151|cDNA
TTTAACATTTTTTTGGTAAAAATATCTATCCTCTTTCTCTCTTTCGTTCATCTTTTGCTCAACTGGATAAACCCCCTACCCATAGTCTTTCTCTGTATTCCTTTGTCTCCCAACACCAATTGCTCGAGCTTCTTCAAAATGGCCACAATCTCATCAGCCATGATTTCATCAACCAGTTACCTCCATCACCACTCAACCTCTAAATCCTTCAAAACCCAGCTACCCAATTCTTTCAAATTAAACCCCAACATTCCTCAAAC...
732 bp · TkA03G526110|TK1151|CDS
TTTAACATTTTTTTGGTAAAAATATCTATCCTCTTTCTCTCTTTCGTTCATCTTTTGCTCAACTGGATAAACCCCCTACCCATAGTCTTTCTCTGTATTCCTTTGTCTCCCAACACCAATTGCTCGAGCTTCTTCAAAATGGCCACAATCTCATCAGCCATGATTTCATCAACCAGTTACCTCCATCACCACTCAACCTCTAAATCCTTCAAAACCCAGCTACCCAATTCTTTCAAATTAAACCCCAACATTCCTCAAAC...
Protein
Download Protein FASTA243 aa · TkA03G526110|TK1151|PROTEIN
FNIFLVKISILFLSFVHLLLNWINPLPIVFLCIPLSPNTNCSSFFKMATISSAMISSTSYLHHHSTSKSFKTQLPNSFKLNPNIPQTSTRFTISPVVSNPRQPTRLLSVAEEAPAAVVTLDPTSEAARRLYVGNIPRTTNNDELQKVFEEHGAVEKVEVMYDKYSGRSRRFGFVTMKTVDDVNAAIEKLNGTEIGGRKIKVNVTEKPLNGVVSILEAEETPFVDSPYKLYVGNLAKNSDVRNT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G526110 |
|---|---|
| TK1151 ID | TkA03G526110 |
| OH-1004 ID | LXL04_010412 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 99.100 |
| Protein coverage (%) | TK1151 95.473 / OH-1004 77.592Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G526110 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:132077984-132079961 (+) | |||||||||
| Description | Similar to PSRP2: 30S ribosomal protein 2, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006397 mRNA processing Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0010029 regulation of seed germination Biological Process GO:0031425 chloroplast RNA processing Biological Process GO:0080148 negative regulation of response to water deprivation Biological Process GO:1900140 regulation of seedling development Biological Process GO:1901001 negative regulation of response to salt stress Biological Process GO:1901259 chloroplast rRNA processing Biological Process GO:0005829 cytosol Cellular Component GO:0005840 ribosome Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G52150 ath:AT3G52380 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF22976RRM_1045-79 aaPF16842RRM_occluded83-128 aaPF04847Calcipressin83-189 aaPF23085RRM_PARP14_3107-121 aaPF22976RRM_10128-199 aaPF16842RRM_occluded129-201 aaPF00076RRM_1130-200 aaPF13893RRM_5130-205 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G526110 | PF22976 | RRM_10 | 45 | 79 | 0.00014 | 22.6 |
| TkA03G526110 | PF16842 | RRM_occluded | 83 | 128 | 0.0002 | 21.9 |
| TkA03G526110 | PF04847 | Calcipressin | 83 | 189 | 0.096 | 13.2 |
| TkA03G526110 | PF23085 | RRM_PARP14_3 | 107 | 121 | 0.029 | 15.2 |
| TkA03G526110 | PF22976 | RRM_10 | 128 | 199 | 0.00014 | 22.6 |
| TkA03G526110 | PF16842 | RRM_occluded | 129 | 201 | 0.0002 | 21.9 |
| TkA03G526110 | PF00076 | RRM_1 | 130 | 200 | 7.9e-22 | 77.6 |
| TkA03G526110 | PF13893 | RRM_5 | 130 | 205 | 0.00043 | 20.7 |
| TkA03G526110 | PF23085 | RRM_PARP14_3 | 130 | 165 | 0.029 | 15.2 |
| TkA03G526110 | PF26250 | RRM_RdRP1_2 | 131 | 185 | 0.014 | 16.5 |
| TkA03G526110 | PF30126 | YHR127W_C | 134 | 204 | 0.15 | 12.7 |
| TkA03G526110 | PF00076 | RRM_1 | 229 | 237 | 7.9e-22 | 77.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.