TkA03G525980 | RubberDandelionOmics

Gene overview

TkA03G525980

Reference: TK1151 Chr: Chr03 Coordinates: 132039151-132043447 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2666 bp · TkA03G525980|TK1151|cDNA

AACTCAACTTTCACCTTTTTCTACAGATTCTGTGAATCTCTGTTTTATACTGGACGGCGAAATCTGGTTTGTTGACCTGACCTGTTTTGTAATTTGATCCGTATAGATAAGCAATTCTGATTTTCTAGGCATCTTGACGACGAAGCACCATTTGATTATGGACTAATCTGTAGCTGAGACTGTTCTTCGGCACCTTGAAATTTGCAACAATGGCAGATGGCCACTTATTCAACAATATATCTCTTGGAGGTCGTGGGGGC...

CDS

Download CDS FASTA

1935 bp · TkA03G525980|TK1151|CDS

ATGGCAGATGGCCACTTATTCAACAATATATCTCTTGGAGGTCGTGGGGGCACAAATCCAGGCCAGCTTAAAGTTCATACAGGTGGCATATTATGGAAGAAACAAGGAGGTGGTAAGGCTATCGAAGTTGACAAGTCTGACATCTCGGGTCTTACCTGGATGAAAGTTCCCCGAACTAATCAGCTTGCTGTTAGAATCAAGGACGGTTTAAAGTACAAGTTCACTGGTTTTCGTGACCAGGATGTTATTAGCCTGACCAA...

Protein

Download Protein FASTA

644 aa · TkA03G525980|TK1151|PROTEIN

MADGHLFNNISLGGRGGTNPGQLKVHTGGILWKKQGGGKAIEVDKSDISGLTWMKVPRTNQLAVRIKDGLKYKFTGFRDQDVISLTNFFQNSCGLTTEEKQLSISGKNWGEVDLNGNSLSFLVGGKQAFEVSLADVSQTQLQGKNDVLLEFHVDDTTGANEKDSLMEISFHIPNNNTQFFGDEHRPPAQLFREKIMSMADVGAGGEEAVVTFEGIAILTPRGRYNVELHLSFLRLQGQANDFKIQFSSVVRVFVLPKSNQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G525980`
TK1151 ID	TkA03G525980
OH-1004 ID	LXL04_010406
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G525980

Location Chr03:132039151-132043447 (-)

Description Similar to SSRP1: FACT complex subunit SSRP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28730`	Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes.	The chromatin remodelling complex FACT associates with actively transcribed regions of the Arabidopsis genome.2004 · DOI: 10.1111/j.1365-313x.2004.02242.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0184900`	Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes.	No verified direct reference in this release
`Os05g0182600`	Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010406 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000741 karyogamy Biological Process

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0048731 system development Biological Process

GO:0000791 euchromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0035101 FACT complex Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT3G28730

dosa:Os01g0184900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.945

Rank 1 · TkA03G525980 · TK1151

Cytoplasm0.158

Rank 2 · TkA03G525980 · TK1151

Cell membrane0.021

Rank 3 · TkA03G525980 · TK1151

Mitochondrion0.015

Rank 4 · TkA03G525980 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA03G525980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17292POB3_N7-98 aa

PF08512Rttp106-like_middle57-91 aa

PF03531SSrecog102-194 aa

PF21103PH1_SSRP1-like207-335 aa

PF17292POB3_N333-433 aa

PF08512Rttp106-like_middle349-440 aa

PF04931DNA_pol_phi403-529 aa

PF02724CDC45438-559 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G525980	`PF17292`	POB3_N	7	98	9.3e-26	90.9
TkA03G525980	`PF08512`	Rttp106-like_middle	57	91	1.6e-24	86.8
TkA03G525980	`PF03531`	SSrecog	102	194	1.6e-27	96.0
TkA03G525980	`PF21103`	PH1_SSRP1-like	207	335	1.3e-48	164.9
TkA03G525980	`PF17292`	POB3_N	333	433	9.3e-26	90.9
TkA03G525980	`PF08512`	Rttp106-like_middle	349	440	1.6e-24	86.8
TkA03G525980	`PF04931`	DNA_pol_phi	403	529	0.26	10.1
TkA03G525980	`PF02724`	CDC45	438	559	0.24	10.3
TkA03G525980	`PF05764`	YL1	453	560	0.2	12.4
TkA03G525980	`PF15794`	CCDC106	514	563	10.0	6.6
TkA03G525980	`PF09011`	HMG_box_2	561	631	1.6e-14	55.1
TkA03G525980	`PF00505`	HMG_box	564	632	4.8e-21	75.7
TkA03G525980	`PF24815`	HMG_WDHD1	569	616	0.14	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q05153`	Arabidopsis thaliana	sp\|Q05153\|SSRP1_ARATH FACT complex subunit SSRP1	77.800%	Swiss-Prot	High
`Q9LGR0`	Oryza sativa subsp. japonica	sp\|Q9LGR0\|SSP1A_ORYSJ FACT complex subunit SSRP1-A	69.900%	Swiss-Prot	High
`Q65WY8`	Oryza sativa subsp. japonica	sp\|Q65WY8\|SSP1B_ORYSJ FACT complex subunit SSRP1-B	65.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card