TkA03G525700 | RubberDandelionOmics

Gene overview

TkA03G525700

Reference: TK1151 Chr: Chr03 Coordinates: 131953778-131958944 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2458 bp · TkA03G525700|TK1151|cDNA

AAAGCCGTGGCGTGTTTCTACAGTGCCGGATCCACCTCCACCTGTTTTGCTCCTGTTCCAAATCCGACCTAGATCCGGCCATTTCCGCTCCATTTTCTGGCCAAGCTTTCTCCGTTACAACATCGAGAACATTCCTGATTTTACGAACACCCCCACGTAATTTATGTTTCTATCCGGCAATAATCTCTTAAAAAAAAAAGGTTTCAATCCAATTACCTCCTTATCGTTGATTTCTGTTTCGATTGAAGAGCAACAGTCGA...

CDS

Download CDS FASTA

1182 bp · TkA03G525700|TK1151|CDS

ATGGGAAAGCAAGACGGAGGTGTAGTTCTTTGCAGCACAAACCCACCACACGAATCATCATCGAAATGCTGCGATGAGTGTAAATCAAACGCATTCAAGTACAAATGCCCAGGTTGCTCCGTACGCTCTTGTAGTCTCCCGTGTGTCAAAGCTCACAAGCAACGCACCGGATGTACAGGCAAAAGACAACAACAAACAGAGTTCGTCCCTCTTTCAAAATTTGACGATAATCTCCTTCTGTCTGATTACAGTATGCTGGA...

Protein

Download Protein FASTA

393 aa · TkA03G525700|TK1151|PROTEIN

MGKQDGGVVLCSTNPPHESSSKCCDECKSNAFKYKCPGCSVRSCSLPCVKAHKQRTGCTGKRQQQTEFVPLSKFDDNLLLSDYSMLEDVKRIADSAKRMRMQICGKYYHGLPFHLKHLLKAAQSRSIRLFFLPTGMSKRETNNTSYNKRQKSISWTIEWRFHSTNVKLIDHGVHENSNLYSVIENHLKPGPTNHPLKPFCLEPIESLKLFISKHPKLPRSPYRELDIHTPIREQLANLVIVEYPVIHVFLPSHKLNFEVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G525700`
TK1151 ID	TkA03G525700
OH-1004 ID	LXL04_010402
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.400
Protein coverage (%)	TK1151 99.491 / OH-1004 99.492 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G525700`
Location	Chr03:131953778-131958944 (+)
Description	Similar to ZNHIT6: Box C/D snoRNA protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010402` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000492 box C/D snoRNP assembly Biological Process GO:0016074 sno(s)RNA metabolic process Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0048254 snoRNA localization Biological Process GO:0051259 protein complex oligomerization Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0070761 pre-snoRNP complex Cellular Component GO:0001094 TFIID-class transcription factor complex binding Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	hsa:54680 mmu:229937 pon:100171529 sce:YHR040W spo:2539305 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.917

Rank 1 · TkA03G525700 · TK1151

Cytoplasm0.189

Rank 2 · TkA03G525700 · TK1151

Mitochondrion0.037

Rank 3 · TkA03G525700 · TK1151

Cell membrane0.019

Rank 4 · TkA03G525700 · TK1151

Golgi apparatus0.010

Rank 5 · TkA03G525700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04438zf-HIT22-50 aa

PF29157LIN13_zf35-52 aa

PF04438zf-HIT103-108 aa

PF25790BCD1116-259 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G525700	`PF04438`	zf-HIT	22	50	1.8e-05	25.1
TkA03G525700	`PF29157`	LIN13_zf	35	52	0.52	10.9
TkA03G525700	`PF04438`	zf-HIT	103	108	1.8e-05	25.1
TkA03G525700	`PF25790`	BCD1	116	259	8.1e-49	166.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card