Gene Card
Gene overview
cDNA / CDS / Protein Sequences
610 bp · TkA03G525450|TK1151|cDNA
CCCGTAAGACTATTAAACTTAAAAACTACAATTCTAAAATACCATTATCGGTTAAAACTAACAGATTTATCAGTTAAATGCCGATGTGTAATAAACTATAGCCACGTGGACATATCAACGTGGACATCCCACACACATCACCTCCCACTTCTCCAGCTATGTTCCTCCCACGCAGTCACCAAGCTCACTGATCTCGACATGTCCGTCAACAAACTCACCGGGAAACTACCGAAACTCGTTTGCCGTCTTCCAAAGCTGCA...
504 bp · TkA03G525450|TK1151|CDS
CCCGTAAGACTATTAAACTTAAAAACTACAATTCTAAAATACCATTATCGGTTAAAACTAACAGATTTATCAGTTAAATGCCGATGTGTAATAAACTATAGCCACGTGGACATATCAACGTGGACATCCCACACACATCACCTCCCACTTCTCCAGCTATGTTCCTCCCACGCAGTCACCAAGCTCACTGATCTCGACATGTCCGTCAACAAACTCACCGGGAAACTACCGAAACTCGTTTGCCGTCTTCCAAAGCTGCA...
Protein
Download Protein FASTA167 aa · TkA03G525450|TK1151|PROTEIN
PVRLLNLKTTILKYHYRLKLTDLSVKCRCVINYSHVDISTWTSHTHHLPLLQLCSSHAVTKLTDLDMSVNKLTGKLPKLVCRLPKLQVFPLYNNSLTGDFGSVGEVGDFNHAVAAFSHEQTVGVKFKEQLFKLIHQLENSNPHFIRCIRPNTKQLWNLRKGYRIRTA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G525450 |
|---|---|
| TK1151 ID | TkA03G525450 |
| OH-1004 ID | LXL04_016682 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 78.800 |
| Protein coverage (%) | TK1151 47.305 / OH-1004 65.574Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G525450 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:131877086-131877889 (+) | |||||||||
| Description | Similar to BAM1: Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002237 response to molecule of bacterial origin Biological Process GO:0002764 immune response-regulating signaling pathway Biological Process GO:0009553 embryo sac development Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0009755 hormone-mediated signaling pathway Biological Process GO:0009934 regulation of meristem structural organization Biological Process GO:0010051 xylem and phloem pattern formation Biological Process GO:0010075 regulation of meristem growth Biological Process GO:0010103 stomatal complex morphogenesis Biological Process GO:0010311 lateral root formation Biological Process GO:0016045 detection of bacterium Biological Process GO:0030154 cell differentiation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G49670 ath:AT5G20480 ath:AT5G49660 ath:AT5G65700 dosa:Os06g0130100 osa:4340000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF06275DUF103117-51 aaPF23598LRR_1445-138 aaPF13855LRR_859-96 aaPF12799LRR_460-96 aaPF00560LRR_161-83 aaPF00560LRR_186-99 aaPF00063Myosin_head116-154 aaPF06275DUF1031128-139 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G525450 | PF06275 | DUF1031 | 17 | 51 | 0.11 | 13.5 |
| TkA03G525450 | PF23598 | LRR_14 | 45 | 138 | 0.0055 | 16.2 |
| TkA03G525450 | PF13855 | LRR_8 | 59 | 96 | 0.051 | 14.0 |
| TkA03G525450 | PF12799 | LRR_4 | 60 | 96 | 0.0061 | 17.5 |
| TkA03G525450 | PF00560 | LRR_1 | 61 | 83 | 0.0059 | 17.2 |
| TkA03G525450 | PF00560 | LRR_1 | 86 | 99 | 0.0059 | 17.2 |
| TkA03G525450 | PF00063 | Myosin_head | 116 | 154 | 3.6e-10 | 39.5 |
| TkA03G525450 | PF06275 | DUF1031 | 128 | 139 | 0.11 | 13.5 |
| TkA03G525450 | PF09280 | XPC-binding | 130 | 157 | 0.12 | 12.8 |
| TkA03G525450 | PF12799 | LRR_4 | 153 | 159 | 0.0061 | 17.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.