TkA03G523310 | RubberDandelionOmics

Gene overview

TkA03G523310

Reference: TK1151 Chr: Chr03 Coordinates: 131373230-131375046 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

826 bp · TkA03G523310|TK1151|cDNA

TAGAGTTTGGTCTATAAAACAAGGATGAGAAGGCGTCTCACTGTCTCTCTTTTCAGGAGTGTTTCATTAGTTGCTTTCTTTTCTTTTCTTTCCATCTTACGTCAGCATCAACAGAGTGAGAGTGAGAGTGAAAGTGAGTGTGAGTGACCAAAAGGATTTGAGAATGAAATCAAGAAAAGATCGAGATCTCTTCTTCTACTTTTGCTCTTCCCTTTTTCCTCTTTCATAATTATCCCTCTTTCTCTTTCTCTTTCTACCCT...

CDS

Download CDS FASTA

360 bp · TkA03G523310|TK1151|CDS

ATGGGATTCTTTCGATTTCCATCTTCTCTCTTCATCTTTCTCCTCATTTTAACCTCCGCCCACTCAAGATTTATACCTCAAGGAGGATCGAATTCGAAGCAGATTAGAAAAGATGACCGGATGGAAAGAAGTAGCCTTTTAATCGGATCAAGACCACCAAGATGTGAGAAGAGTTATTGTAGAAATTGCGGTAATTGTGTGGCAGTTCAAGTCCCAATCGTACCTAGACTCATTAGAACAAGTCAAGAAGCACTGGGTAC...

Protein

Download Protein FASTA

119 aa · TkA03G523310|TK1151|PROTEIN

MGFFRFPSSLFIFLLILTSAHSRFIPQGGSNSKQIRKDDRMERSSLLIGSRPPRCEKSYCRNCGNCVAVQVPIVPRLIRTSQEALGTTHKSIVDSRGDDISNYKPMCWKCKCGDFMFNP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G523310`
TK1151 ID	TkA03G523310
OH-1004 ID	LXL04_010373
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G523310

Location Chr03:131373230-131375046 (-)

Description Similar to EPFL2: EPIDERMAL PATTERNING FACTOR-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37810`	Controls stomatal patterning.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010373 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010052 guard cell differentiation Biological Process

GO:0010374 stomatal complex development Biological Process

GO:0048481 plant ovule development Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT4G37810

ath:AT5G10310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.686

Rank 1 · TkA03G523310 · TK1151

Cell membrane0.135

Rank 2 · TkA03G523310 · TK1151

Endoplasmic reticulum0.098

Rank 3 · TkA03G523310 · TK1151

Cytoplasm0.059

Rank 4 · TkA03G523310 · TK1151

Golgi apparatus0.050

Rank 5 · TkA03G523310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29047DF258-like_N9-19 aa

PF29047DF258-like_N41-46 aa

PF16851Stomagen46-73 aa

PF17181EPF48-119 aa

PF16851Stomagen103-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G523310	`PF29047`	DF258-like_N	9	19	3.9	8.5
TkA03G523310	`PF29047`	DF258-like_N	41	46	3.9	8.5
TkA03G523310	`PF16851`	Stomagen	46	73	0.0032	18.2
TkA03G523310	`PF17181`	EPF	48	119	4.3e-14	52.9
TkA03G523310	`PF16851`	Stomagen	103	111	0.0032	18.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T068`	Arabidopsis thaliana	sp\|Q9T068\|EPFL2_ARATH EPIDERMAL PATTERNING FACTOR-like protein 2	41.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card