Gene Card
Gene overview
cDNA / CDS / Protein Sequences
4513 bp · TkA03G522840|TK1151|cDNA
TATTTTTAAAAGAATCGTAATATTGACACCAGAGCCGAGCCGCACCCAGCCATTCATTGCAACCCTAATACTGTAATACACACACGCATAACGCACCCTCGCAAATAATTCCTTCTTTCATTTCATCGTCACTCCCATCCCTCTCCTCTTCTTTATTCATATTTTGCTTCCACCATTCTCAACTGATCTGTGTATAAATTACAGTTTTTCTAATACAAATCTATCATATACACACTTATCACGAATTCACATCGACAAGG...
3780 bp · TkA03G522840|TK1151|CDS
ATGGGGAAAAAGAAGCCGACAGCTCGTGAGGAGGACGGAGGTGCGGGTGGGGGCAAGTCGAGGAAGAAAGCTGTAGTGATTGATGATGATGAGTATGCTATTGGAATAGAAGTGTCCGAGGAGAAATCAGTTCAGGAAGAAGAGTATGTCGCACCTGTTGCTGGTAAGAAAAAAGGTAAGAAAGGTAAGAATTCACGGATGAAAGACGAAGAAGAAGATGTGGATGAAGGTGATGATCCTCAGGAGATTCAGTTTACTGG...
Protein
Download Protein FASTA1259 aa · TkA03G522840|TK1151|PROTEIN
MGKKKPTAREEDGGAGGGKSRKKAVVIDDDEYAIGIEVSEEKSVQEEEYVAPVAGKKKGKKGKNSRMKDEEEDVDEGDDPQEIQFTGKKNSKSKAKKGDFSASFALLGDEDDETSEVTKDEEEDDVSEEEDTSLVFTGKKKKGGNSFAGSAFAAIGDDDDNDHDEDLPDKSGSKQQSEDEDDEPVISFTGKKKSSKSNKKTSGSVFSAAHLLDEENEKESDEDDDAPITFSGKKKSSKSLKKKTTPSTGGGTDEDVSVSG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G522840 |
|---|---|
| TK1151 ID | TkA03G522840 |
| OH-1004 ID | LXL04_010366 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 97.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G522840 |
|---|---|
| Location | Chr03:131234211-131239697 (+) |
| Description | Similar to SPAC56F8.03: Eukaryotic translation initiation factor 5B (Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002183 cytoplasmic translational initiation Biological Process GO:0006413 translational initiation Biological Process GO:0006446 regulation of translational initiation Biological Process GO:0042255 ribosome assembly Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0033290 eukaryotic 48S preinitiation complex Cellular Component GO:0000049 tRNA binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003743 translation initiation factor activity Molecular Function GO:0003924 GTPase activity Molecular Function |
| KEGG gene cross-reference | cthr:CTHT_0029840 hsa:9669 mmu:226982 rno:308306 spo:2543241 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14578GTP_EFTU_D426-82 aaPF03144GTP_EFTU_D257-99 aaPF03144GTP_EFTU_D2548-572 aaPF00009GTP_EFTU670-879 aaPF01926MMR_HSR1673-793 aaPF14578GTP_EFTU_D4807-828 aaPF03144GTP_EFTU_D2906-980 aaPF01926MMR_HSR1962-998 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G522840 | PF14578 | GTP_EFTU_D4 | 26 | 82 | 3.3e-16 | 59.7 |
| TkA03G522840 | PF03144 | GTP_EFTU_D2 | 57 | 99 | 1.1e-08 | 36.1 |
| TkA03G522840 | PF03144 | GTP_EFTU_D2 | 548 | 572 | 1.1e-08 | 36.1 |
| TkA03G522840 | PF00009 | GTP_EFTU | 670 | 879 | 1e-34 | 120.5 |
| TkA03G522840 | PF01926 | MMR_HSR1 | 673 | 793 | 4.4e-06 | 27.5 |
| TkA03G522840 | PF14578 | GTP_EFTU_D4 | 807 | 828 | 3.3e-16 | 59.7 |
| TkA03G522840 | PF03144 | GTP_EFTU_D2 | 906 | 980 | 1.1e-08 | 36.1 |
| TkA03G522840 | PF01926 | MMR_HSR1 | 962 | 998 | 4.4e-06 | 27.5 |
| TkA03G522840 | PF11987 | IF-2 | 995 | 1108 | 9.2e-23 | 81.1 |
| TkA03G522840 | PF14578 | GTP_EFTU_D4 | 1129 | 1220 | 3.3e-16 | 59.7 |
| TkA03G522840 | PF03144 | GTP_EFTU_D2 | 1149 | 1205 | 1.1e-08 | 36.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.