TkA03G522510 | RubberDandelionOmics

Gene overview

TkA03G522510

Reference: TK1151 Chr: Chr03 Coordinates: 131129235-131132992 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3340 bp · TkA03G522510|TK1151|cDNA

GAAAGATATTGGTATTATTATGAAGATAGAGGAACACGTGAAGACCAAGAGGACTGACACGTCCTCCTGTCATAACAAGCGCGTGACGCAAAAATTCCAGTTGGCATCCCAACTTTCTTTGCTGGCCGACCTTATCCCCTTCCTCCTTCCCCCATTTCACCTTCTTTTTCTTTCTTCACATTTAAATAATCACCATCTTCTCTTCTCTAACAGCTTTTCATTTTTCTGCACAACAACACCTTCAAGATCCATTACAGATA...

CDS

Download CDS FASTA

2601 bp · TkA03G522510|TK1151|CDS

ATGATTTCGAAATCGTATGCCAACTTGTTAGATCTAGCCAATGGAAATTTTCCAGCTATGGAAGAACCTAGAAGGAAGATGATCTCCAGGACAATGACTGTCCCTGGAGTTCTAACCGAACTCGAGGACGATCAGGCTCGCAGTGTTTCATCTGATGCCCCTTCGACGGTTTTGGCGGATAGGTTAATCGTTGTAGCAAATCAATTGCCGATTAAAGCAACCCGTAAGATCGATGATAACGGTGAATCAACATGGAACTT...

Protein

Download Protein FASTA

866 aa · TkA03G522510|TK1151|PROTEIN

MISKSYANLLDLANGNFPAMEEPRRKMISRTMTVPGVLTELEDDQARSVSSDAPSTVLADRLIVVANQLPIKATRKIDDNGESTWNFTWDENSLYKHIKDGLPDEMEVIYVGSLRADIDPSEQDDVSQILLERFKCVPAFLPPDVLDKYYHGFCKQHLWPLFHYRLPFSASHGGRFDRSLWEAYVAANKIFSQKIIEVINPDDDYVWIHDYHLMVLPSFLRRHFNRLRMGFFLHSPFPSSEIYRTLPVREEILKSLLNAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G522510`
TK1151 ID	TkA03G522510
OH-1004 ID	LXL04_010360
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G522510

Location Chr03:131129235-131132992 (+)

Description Similar to TPS7: Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06410`	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7.	No verified direct reference in this release
`At4g17770`	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5.	No verified direct reference in this release
`At1g68020`	Regulates plant architecture, shape of epidermal pavement cells and branching of trichomes.	Trehalose-6-phosphate synthase/phosphatase regulates cell shape and plant architecture in Arabidopsis.2008 · DOI: 10.1104/pp.107.107441
`At1g70290`	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8.	No verified direct reference in this release
`At1g23870`	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010360 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005992 trehalose biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003825 alpha,alpha-trehalose-phosphate synthase (UDP-forming) activity Molecular Function

GO:0004805 trehalose-phosphatase activity Molecular Function

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06410

ath:AT1G23870

ath:AT1G68020

ath:AT1G70290

ath:AT4G17770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.404

Rank 1 · TkA03G522510 · TK1151

Nucleus0.280

Rank 2 · TkA03G522510 · TK1151

Cell membrane0.209

Rank 3 · TkA03G522510 · TK1151

Lysosome / Vacuole0.088

Rank 4 · TkA03G522510 · TK1151

Golgi apparatus0.080

Rank 5 · TkA03G522510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00982Glyco_transf_2061-546 aa

PF10464Peptidase_U40389-422 aa

PF02358Trehalose_PPase501-524 aa

PF08282Hydrolase_3595-647 aa

PF02358Trehalose_PPase596-831 aa

PF08282Hydrolase_3724-797 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G522510	`PF00982`	Glyco_transf_20	61	546	2.5e-171	571.3
TkA03G522510	`PF10464`	Peptidase_U40	389	422	0.33	11.3
TkA03G522510	`PF02358`	Trehalose_PPase	501	524	4.1e-81	272.3
TkA03G522510	`PF08282`	Hydrolase_3	595	647	0.00028	21.4
TkA03G522510	`PF02358`	Trehalose_PPase	596	831	4.1e-81	272.3
TkA03G522510	`PF08282`	Hydrolase_3	724	797	0.00028	21.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMI0`	Arabidopsis thaliana	sp\|Q9LMI0\|TPS7_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7	69.400%	Swiss-Prot	High
`O23617`	Arabidopsis thaliana	sp\|O23617\|TPS5_ARATH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5	61.700%	Swiss-Prot	High
`Q94AH8`	Arabidopsis thaliana	sp\|Q94AH8\|TPS6_ARATH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6	60.500%	Swiss-Prot	High
`Q0WUI9`	Arabidopsis thaliana	sp\|Q0WUI9\|TPS8_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8	57.800%	Swiss-Prot	High
`Q9LRA7`	Arabidopsis thaliana	sp\|Q9LRA7\|TPS9_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9	57.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card