TkA03G519920 | RubberDandelionOmics

Gene overview

TkA03G519920

Reference: TK1151 Chr: Chr03 Coordinates: 130455165-130455982 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · TkA03G519920|TK1151|cDNA

TTTCAGGAGGGAGATTATCATGTGGATGCTCGCCATCTAGTTGTCAAATCACCTCCAAGCGGGAATTTCATCTTGGAAAACGTTACTGAAATCTTACCACAAAAGAACACATCATTAGAGAATGTAGGCAAGTCGTCTGGTAACTTCTGTACACAATGTGAAGCTGAAGGTTTCCGCAAGATAACTTTTTACCAGGATCGCCCTGATATTATGGCGAAATACACCTGTCGCATTGAAGCTGACAAGTCACTGTACCCTGT...

CDS

Download CDS FASTA

573 bp · TkA03G519920|TK1151|CDS

TTTCAGGAGGGAGATTATCATGTGGATGCTCGCCATCTAGTTGTCAAATCACCTCCAAGCGGGAATTTCATCTTGGAAAACGTTACTGAAATCTTACCACAAAAGAACACATCATTAGAGAATGTAGGCAAGTCGTCTGGTAACTTCTGTACACAATGTGAAGCTGAAGGTTTCCGCAAGATAACTTTTTACCAGGATCGCCCTGATATTATGGCGAAATACACCTGTCGCATTGAAGCTGACAAGTCACTGTACCCTGT...

Protein

Download Protein FASTA

190 aa · TkA03G519920|TK1151|PROTEIN

FQEGDYHVDARHLVVKSPPSGNFILENVTEILPQKNTSLENVGKSSGNFCTQCEAEGFRKITFYQDRPDIMAKYTCRIEADKSLYPVLLSNGNLIEQGDLEGGKHFALWKDSFKKSCYLFALVAGQLESRDDTFTTCSGRKVALRIWTPPQDIPKTEHAMYSFKAAMKWDEEVSFYLFYIIIIFIVSLTC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G519920`
TK1151 ID	TkA03G519920
OH-1004 ID	LXL04_010339
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.800
Protein coverage (%)	TK1151 100.000 / OH-1004 80.488 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G519920

Location Chr03:130455165-130455982 (-)

Description Similar to Os08g0562700: Puromycin-sensitive aminopeptidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63770`	Aminopeptidase with broad substrate specificity for several peptides.	A puromycin-sensitive aminopeptidase is essential for meiosis in Arabidopsis thaliana.2004 · DOI: 10.1105/tpc.104.024992 An analysis of univalent segregation in meiotic mutants of Arabidopsis thaliana: a possible role for synaptonemal complex.2007 · DOI: 10.1534/genetics.106.067595

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0562700`	Puromycin-sensitive aminopeptidase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010339 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004177 aminopeptidase activity Molecular Function

GO:0008237 metallopeptidase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016285 alanyl aminopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G63770

ccr:CC_2481

dosa:Os08g0562700

ecj:JW0915

eco:b0932

ecoc:C3026_05725

hin:HI_1614

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.445

Rank 1 · TkA03G519920 · TK1151

Cytoplasm0.228

Rank 2 · TkA03G519920 · TK1151

Endoplasmic reticulum0.159

Rank 3 · TkA03G519920 · TK1151

Nucleus0.145

Rank 4 · TkA03G519920 · TK1151

Extracellular0.129

Rank 5 · TkA03G519920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17900Peptidase_M1_N43-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G519920	`PF17900`	Peptidase_M1_N	43	119	3.1e-13	50.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H0S9`	Arabidopsis thaliana	sp\|Q8H0S9\|PSA_ARATH Puromycin-sensitive aminopeptidase	75.900%	Swiss-Prot	High
`B7EA73`	Oryza sativa subsp. japonica	sp\|B7EA73\|PSA_ORYSJ Puromycin-sensitive aminopeptidase	79.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card