TkA03G519870 | RubberDandelionOmics

Gene overview

TkA03G519870

Reference: TK1151 Chr: Chr03 Coordinates: 130437668-130438719 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

709 bp · TkA03G519870|TK1151|cDNA

ATGCATGTAACAACCCAGTGGCTTCTAAGACATACCCAACAGACGATGGAGATGATCGTGAACATGGACTGCCATGGCTGTGAACGGAAAGTTAGAAAGGCCCTTGAAAACTTAGACGGAGTGGAGAATGTTGATATCGACATGGAATTGCAAAAGGTAACAGTGACGGGATGGGCGGATCAAGAAAAGGTTCTGAAGAAAGTGAGGAAGACGGGAAGGAAAGCAGAGTTATGGCCGTTTCCATACAACGCCGACGTGAT...

CDS

Download CDS FASTA

468 bp · TkA03G519870|TK1151|CDS

ATGCATGTAACAACCCAGTGGCTTCTAAGACATACCCAACAGACGATGGAGATGATCGTGAACATGGACTGCCATGGCTGTGAACGGAAAGTTAGAAAGGCCCTTGAAAACTTAGACGGAGTGGAGAATGTTGATATCGACATGGAATTGCAAAAGGTAACAGTGACGGGATGGGCGGATCAAGAAAAGGTTCTGAAGAAAGTGAGGAAGACGGGAAGGAAAGCAGAGTTATGGCCGTTTCCATACAACGCCGACGTGAT...

Protein

Download Protein FASTA

155 aa · TkA03G519870|TK1151|PROTEIN

MHVTTQWLLRHTQQTMEMIVNMDCHGCERKVRKALENLDGVENVDIDMELQKVTVTGWADQEKVLKKVRKTGRKAELWPFPYNADVIGFTEQYGDMYAHHSDPATYFHGEQPDISRHNYYGHVTDQEYLPYSSIGVEEKASIAFNDENVNACSIM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G519870`
TK1151 ID	TkA03G519870
OH-1004 ID	LXL04_010336
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G519870

Location Chr03:130437668-130438719 (+)

Description Similar to HIPP28: Heavy metal-associated isoprenylated plant protein 28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06330`	Heavy-metal-binding protein.	No verified direct reference in this release
`At3g56891`	Heavy-metal-binding protein.	No verified direct reference in this release
`At4g39700`	Heavy-metal-binding protein.	No verified direct reference in this release
`At4g10465`	Heavy-metal-binding protein.	No verified direct reference in this release
`At1g71050`	Heavy-metal-binding protein.	Metallochaperone-like genes in Arabidopsis thaliana.2010 · DOI: 10.1039/c003484c

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010336 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G29100

ath:AT2G18196

ath:AT3G56891

ath:AT4G10465

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.367

Rank 1 · TkA03G519870 · TK1151

Nucleus0.353

Rank 2 · TkA03G519870 · TK1151

Cell membrane0.255

Rank 3 · TkA03G519870 · TK1151

Endoplasmic reticulum0.090

Rank 4 · TkA03G519870 · TK1151

Mitochondrion0.069

Rank 5 · TkA03G519870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19803DUF62869-69 aa

PF00403HMA18-74 aa

PF04972BON28-63 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G519870	`PF19803`	DUF6286	9	69	0.0049	18.0
TkA03G519870	`PF00403`	HMA	18	74	1.6e-17	64.3
TkA03G519870	`PF04972`	BON	28	63	0.15	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IC29`	Arabidopsis thaliana	sp\|F4IC29\|HIP28_ARATH Heavy metal-associated isoprenylated plant protein 28	49.300%	Swiss-Prot	Medium
`B3H6D0`	Arabidopsis thaliana	sp\|B3H6D0\|HIP45_ARATH Heavy metal-associated isoprenylated plant protein 45	41.600%	Swiss-Prot	Medium
`O65657`	Arabidopsis thaliana	sp\|O65657\|HIP23_ARATH Heavy metal-associated isoprenylated plant protein 23	39.200%	Swiss-Prot	Medium
`F4JMB8`	Arabidopsis thaliana	sp\|F4JMB8\|HIP44_ARATH Heavy metal-associated isoprenylated plant protein 44	41.300%	Swiss-Prot	Medium
`Q9C9A3`	Arabidopsis thaliana	sp\|Q9C9A3\|HIP20_ARATH Heavy metal-associated isoprenylated plant protein 20	36.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card