TkA03G518400 | RubberDandelionOmics

Gene overview

TkA03G518400

Reference: TK1151 Chr: Chr03 Coordinates: 130088164-130089102 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

396 bp · TkA03G518400|TK1151|cDNA

AAAGGATCTGGAAATGATAAGATTGTAGCATCCGTGCTGTTTGAGAGGCTTCCGGTTGTAATCCCCAAAATCGATCCCGTCGTCTACGGTTTTCAAGAATTATCCTTTCGTTGGAGACAGCAGTTTCGGCGTGCATATCCTGAAGAATTCCTCAAAAAATCCGATGCTAGGGGTAAAGGTGAATACCACATTGATTTTGTACCGGCTCCTAGGATCACTGAAGCTGACAAAATCAATGATAAAAAGTCATTGCAAAGAGC...

CDS

Download CDS FASTA

396 bp · TkA03G518400|TK1151|CDS

AAAGGATCTGGAAATGATAAGATTGTAGCATCCGTGCTGTTTGAGAGGCTTCCGGTTGTAATCCCCAAAATCGATCCCGTCGTCTACGGTTTTCAAGAATTATCCTTTCGTTGGAGACAGCAGTTTCGGCGTGCATATCCTGAAGAATTCCTCAAAAAATCCGATGCTAGGGGTAAAGGTGAATACCACATTGATTTTGTACCGGCTCCTAGGATCACTGAAGCTGACAAAATCAATGATAAAAAGTCATTGCAAAGAGC...

Protein

Download Protein FASTA

131 aa · TkA03G518400|TK1151|PROTEIN

KGSGNDKIVASVLFERLPVVIPKIDPVVYGFQELSFRWRQQFRRAYPEEFLKKSDARGKGEYHIDFVPAPRITEADKINDKKSLQRALDRRLYLLLYGDSSYGSQKGDVWPLSLKKFTSLKRPYASVQNLH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G518400`
TK1151 ID	TkA03G518400
OH-1004 ID	LXL04_026692
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.000
Protein coverage (%)	TK1151 90.840 / OH-1004 50.638 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G518400`
Location	Chr03:130088164-130089102 (-)
Description	Similar to MRPL46: 39S ribosomal protein L46, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026692` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0032543 mitochondrial translation Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005762 mitochondrial large ribosomal subunit Cellular Component GO:0005829 cytosol Cellular Component GO:0030054 cell junction Cellular Component GO:0003735 structural constituent of ribosome Molecular Function
KEGG gene cross-reference	bta:540720 hsa:26589 mmu:67308 rno:293054 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.340

Rank 1 · TkA03G518400 · TK1151

Nucleus0.325

Rank 2 · TkA03G518400 · TK1151

Mitochondrion0.246

Rank 3 · TkA03G518400 · TK1151

Endoplasmic reticulum0.059

Rank 4 · TkA03G518400 · TK1151

Cell membrane0.057

Rank 5 · TkA03G518400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11788MRP-L467-54 aa

PF11788MRP-L4640-76 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G518400	`PF11788`	MRP-L46	7	54	0.0045	18.4
TkA03G518400	`PF11788`	MRP-L46	40	76	0.0045	18.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card