TkA03G518240 | RubberDandelionOmics

Gene overview

TkA03G518240

Reference: TK1151 Chr: Chr03 Coordinates: 129987480-129989886 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1359 bp · TkA03G518240|TK1151|cDNA

TCTGCTTTCCTTCTTGATTGTTCGTAAACTCATCATCACCACTTCCCATCGCATATTCTTTAAATAGCTCTGGTTCCCCATTTTGCTTCGAAAACGGGATTCGGAATCTGAATTTGAAGGCTTTCTGCTCTGCAAACACAAAGTGTAACATCAACGATGGGATCAAGTGATTGGTTGAAGAATATAATCAACTCAAATAAAGCCAGGAAACAAAAAACTAACAAGATAAAGGAAAATTCATTTCGTGAAACAAATGGTTT...

CDS

Download CDS FASTA

885 bp · TkA03G518240|TK1151|CDS

ATGGGATCAAGTGATTGGTTGAAGAATATAATCAACTCAAATAAAGCCAGGAAACAAAAAACTAACAAGATAAAGGAAAATTCATTTCGTGAAACAAATGGTTTTTTTTATAAAACCCGACCTACAGAGGAACCAAATAATATTGTTAACGGCGTTGCTAAAGTACGCCGTGAGGCTGTTAGTCTGCCTGTTGAGGATTTAGCAGCAATAAAGATCCAAACTGCATACAGAGCATTTAAGGCAAGAAAGTATGTCTGCAA...

Protein

Download Protein FASTA

294 aa · TkA03G518240|TK1151|PROTEIN

MGSSDWLKNIINSNKARKQKTNKIKENSFRETNGFFYKTRPTEEPNNIVNGVAKVRREAVSLPVEDLAAIKIQTAYRAFKARKYVCNLKRLVRLQMLMEGEFGKKQTSSTLRNLQTWSRLQSQIRTRRLAKVEDSGIKQKKLENQLKLDSKMEWSGSSHTMGEALARMKQREEATIKRERAMAYAFSHQWRAHSNSNVGVNDADVAASNWGWSWMERWIAARPWENRALGGSTPKKVNSPPSKKSPSIKKSNSPNGKKML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G518240`
TK1151 ID	TkA03G518240
OH-1004 ID	LXL04_010298
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 94.534 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G518240

Location Chr03:129987480-129989886 (+)

Description Similar to IQD1: Protein IQ-DOMAIN 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15050`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At2g33990`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g52290`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At5g03040`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At2g26410`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010298 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016604 nuclear body Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT2G26410

ath:AT2G33990

ath:AT3G15050

ath:AT3G52290

ath:AT5G03040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.401

Rank 1 · TkA03G518240 · TK1151

Cell membrane0.393

Rank 2 · TkA03G518240 · TK1151

Nucleus0.334

Rank 3 · TkA03G518240 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA03G518240 · TK1151

Plastid0.040

Rank 5 · TkA03G518240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00612IQ68-84 aa

PF00612IQ119-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G518240	`PF00612`	IQ	68	84	0.00053	20.3
TkA03G518240	`PF00612`	IQ	119	126	0.00053	20.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LKA0`	Arabidopsis thaliana	sp\|Q9LKA0\|IQD10_ARATH Protein IQ-DOMAIN 10	39.100%	Swiss-Prot	Medium
`Q0WNP8`	Arabidopsis thaliana	sp\|Q0WNP8\|IQD9_ARATH Protein IQ-DOMAIN 9	42.200%	Swiss-Prot	Medium
`Q9FT53`	Arabidopsis thaliana	sp\|Q9FT53\|IQD3_ARATH Protein IQ-DOMAIN 3	34.100%	Swiss-Prot	Medium
`Q93ZH7`	Arabidopsis thaliana	sp\|Q93ZH7\|IQD2_ARATH Protein IQ-DOMAIN 2	33.900%	Swiss-Prot	Medium
`F4IUJ7`	Arabidopsis thaliana	sp\|F4IUJ7\|IQD4_ARATH Protein IQ-DOMAIN 4	31.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card