TkA03G517550 | RubberDandelionOmics

Gene overview

TkA03G517550

Reference: TK1151 Chr: Chr03 Coordinates: 129848069-129852649 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1452 bp · TkA03G517550|TK1151|cDNA

TTTATGTCTTTTCAATATTAAACAGGTAGTCAAACCAACCACACTTTAAAGGGTATTTTAAGAAACCATGTCAAGTGAACCATCTCAACTTCTATGATTTGAAGTCATATCTACTCTCCTTGAATCCCTCTCCAAAAAATGAAAGTTTCTCCCTTAAGACTTTCTTTAAAGATTACACTAGTACTCTTACTCCACATTCTTCTCATCTTGGTATCCATTAATGCTAAACCACAAGATGATCTTATCATGAAAACCGAAAT...

CDS

Download CDS FASTA

1122 bp · TkA03G517550|TK1151|CDS

ATGAAAGTTTCTCCCTTAAGACTTTCTTTAAAGATTACACTAGTACTCTTACTCCACATTCTTCTCATCTTGGTATCCATTAATGCTAAACCACAAGATGATCTTATCATGAAAACCGAAATAAACCACAAGGTTTCCGCTGTTTTGGTGTTTGGAGACTCCACTTCTGACCCTGGAAACAACAATTACATTCTCACCCCTTTCAAGGGAAATTTCCCACCTTATGGGAGAGATTTTGCAAACCAGAAACCGACGGGGAG...

Protein

Download Protein FASTA

373 aa · TkA03G517550|TK1151|PROTEIN

MKVSPLRLSLKITLVLLLHILLILVSINAKPQDDLIMKTEINHKVSAVLVFGDSTSDPGNNNYILTPFKGNFPPYGRDFANQKPTGRFTNGLLTSDLVARYLGVKDNIPPYLDPSLTIHDLMTGVSFASAGSGYDPLTPTISNVIPLQRQLEYFREYKVRLTAKLGVRRAQEIINNALYLVSAGTNDFVVNYFTLPVRRQEFSLPSYMDFLMNKELEFLQGLLDEGARKIGVAGLPPMGCLPIVITLFSKDAVLERGCID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G517550`
TK1151 ID	TkA03G517550
OH-1004 ID	LXL04_010293
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G517550

Location Chr03:129848069-129852649 (+)

Description Similar to At5g45960: GDSL esterase/lipase At5g45960

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45960`	GDSL esterase/lipase At5g45960.	No verified direct reference in this release
`At1g06990`	GDSL esterase/lipase At1g06990.	No verified direct reference in this release
`At2g31540`	GDSL esterase/lipase At2g31540.	No verified direct reference in this release
`At3g16370`	GDSL esterase/lipase APG.	No verified direct reference in this release
`At5g45950`	GDSL esterase/lipase At5g45950.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010293 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT1G06990

ath:AT2G31540

ath:AT3G16370

ath:AT5G45950

ath:AT5G45960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.338

Rank 1 · TkA03G517550 · TK1151

Lysosome / Vacuole0.261

Rank 2 · TkA03G517550 · TK1151

Endoplasmic reticulum0.123

Rank 3 · TkA03G517550 · TK1151

Cytoplasm0.101

Rank 4 · TkA03G517550 · TK1151

Cell membrane0.097

Rank 5 · TkA03G517550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL48-362 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G517550	`PF00657`	Lipase_GDSL	48	362	3.7e-30	106.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ40`	Arabidopsis thaliana	sp\|Q9FJ40\|GDL86_ARATH GDSL esterase/lipase At5g45960	58.800%	Swiss-Prot	High
`Q9LMJ3`	Arabidopsis thaliana	sp\|Q9LMJ3\|GDL1_ARATH GDSL esterase/lipase At1g06990	44.800%	Swiss-Prot	Medium
`Q9SIQ3`	Arabidopsis thaliana	sp\|Q9SIQ3\|GDL43_ARATH GDSL esterase/lipase At2g31540	45.300%	Swiss-Prot	Medium
`Q9LU14`	Arabidopsis thaliana	sp\|Q9LU14\|APG2_ARATH GDSL esterase/lipase APG	44.400%	Swiss-Prot	Medium
`Q9FJ41`	Arabidopsis thaliana	sp\|Q9FJ41\|GDL85_ARATH GDSL esterase/lipase At5g45950	43.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card