TkA03G516600 | RubberDandelionOmics

Gene overview

TkA03G516600

Reference: TK1151 Chr: Chr03 Coordinates: 129626478-129627735 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1111 bp · TkA03G516600|TK1151|cDNA

ATATGTTTGATAGGTAGTTTATAAAGTCCGTGAAGGGAGGACCTAACTATTACCACATATTTCTCAGTCTACTATATACAAGTACAAATCATCCACAACAAACTGTATCAGAAAACTAAAACAAAACTCTAATCATCGTCCATCTTAAATCTCTTTCTCTCTTTCTTCCCATTCTTCTTCATCTCTCCATAAACAAAGTTTCCATGATCTCCCTATAATCAATGGCGGTTAACAATCCTTGTTCATGGTTAAAGCTGTTT...

CDS

Download CDS FASTA

498 bp · TkA03G516600|TK1151|CDS

ATGCACCAACGAATTCAGCTATCAATTCAAATCCTCCACCTGGATCGAAACCAACAATTATCACATAAAGGAGGACGACAGGTCGACCATCATCACCCAAATTTGGGAAATCCCCAGTCACGAAAGATCTCAGAAGCAACAAAATTCATACTATCGAGGCACAGACATGCAGTTATTGTATACGACATCATTCGTAAAGCAACGTTCAGAAACGTTGAAAATGGGTCAAAGAGGTGCGAGATTACACAGATCAAAACTCA...

Protein

Download Protein FASTA

165 aa · TkA03G516600|TK1151|PROTEIN

MHQRIQLSIQILHLDRNQQLSHKGGRQVDHHHPNLGNPQSRKISEATKFILSRHRHAVIVYDIIRKATFRNVENGSKRCEITQIKTHDHACGHKADRSHLRAVKTEEAKAYAEKENLLFMETSATDSLNLQNALKSLIIPIYHKRKATTMRQTVKHGGESRNCIP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G516600`
TK1151 ID	TkA03G516600
OH-1004 ID	LXL04_010287
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	48.900
Protein coverage (%)	TK1151 52.727 / OH-1004 40.741 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G516600

Location Chr03:129626478-129627735 (+)

Description Similar to RABA1F: Ras-related protein RABA1f

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60860`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At3g15060`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At1g28550`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At2g33870`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010287 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0005768 endosome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ath:AT1G28550

ath:AT3G15060

ath:AT4G18430

ath:AT5G60860

nta:107770722

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.476

Rank 1 · TkA03G516600 · TK1151

Nucleus0.302

Rank 2 · TkA03G516600 · TK1151

Mitochondrion0.108

Rank 3 · TkA03G516600 · TK1151

Cell membrane0.076

Rank 4 · TkA03G516600 · TK1151

Endoplasmic reticulum0.060

Rank 5 · TkA03G516600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07180CaiF_GrlA41-120 aa

PF00071Ras47-138 aa

PF10829DUF255480-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G516600	`PF07180`	CaiF_GrlA	41	120	0.12	13.1
TkA03G516600	`PF00071`	Ras	47	138	2.3e-14	54.0
TkA03G516600	`PF10829`	DUF2554	80	114	0.053	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJH0`	Arabidopsis thaliana	sp\|Q9FJH0\|RAA1F_ARATH Ras-related protein RABA1f	46.500%	Swiss-Prot	Medium
`Q9LK99`	Arabidopsis thaliana	sp\|Q9LK99\|RAA1G_ARATH Ras-related protein RABA1g	46.700%	Swiss-Prot	Medium
`Q9S810`	Arabidopsis thaliana	sp\|Q9S810\|RAA1I_ARATH Ras-related protein RABA1i	38.300%	Swiss-Prot	Medium
`Q1PEX3`	Arabidopsis thaliana	sp\|Q1PEX3\|RAA1H_ARATH Ras-related protein RABA1h	46.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card