TkA03G516310 | RubberDandelionOmics

Gene overview

TkA03G516310

Reference: TK1151 Chr: Chr03 Coordinates: 129551720-129555213 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1928 bp · TkA03G516310|TK1151|cDNA

CTTTTCTCAATTTCTGAAAGCGAAGATAAAAAAAAAGATCAAAACTTTGTGGTACCCAAAACACACGACCAGGAGACCAAGAACAGATGGCGGGAGATGAGGGGAGAACTCTTGAAGTAACACCAACATGGGCAGTCGCTACTGTCACTCTCAGTTTAATCGTAGTTTCAATTCTTATCGAACATGTTCTTCATCTATTAGCAAAGTACTTCAATAAGAAACGACGGAAATCTTTGATCAAAGCACTTGACCAGATTAAA...

CDS

Download CDS FASTA

1464 bp · TkA03G516310|TK1151|CDS

ATGGCGGGAGATGAGGGGAGAACTCTTGAAGTAACACCAACATGGGCAGTCGCTACTGTCACTCTCAGTTTAATCGTAGTTTCAATTCTTATCGAACATGTTCTTCATCTATTAGCAAAGTACTTCAATAAGAAACGACGGAAATCTTTGATCAAAGCACTTGACCAGATTAAATCAGAGATGGTGAGATTAGGGTTCTTATCGTTGTTGCTGATTGTCTGTGAGGAGTCTGTCGCTAATATCTGTATCCCAAAGAGCGC...

Protein

Download Protein FASTA

487 aa · TkA03G516310|TK1151|PROTEIN

MAGDEGRTLEVTPTWAVATVTLSLIVVSILIEHVLHLLAKYFNKKRRKSLIKALDQIKSEMVRLGFLSLLLIVCEESVANICIPKSAGKNFLPCEDHESDAEEAAKCADQGKISLISRNGVQQLQFLISILAISHVISCILTFSLGMLKMRNWEAWEETTRTLEYKYSNDPRRFQFVHQTSFGKRHLRFWSGLRLFRLPISFINASFLRQFYGSVSKVDYFILRHGFITAHFDEGTTFDFQKYLRKALEKDFGVVVGVSP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G516310`
TK1151 ID	TkA03G516310
OH-1004 ID	LXL04_010269
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 88.440 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G516310

Location Chr03:129551720-129555213 (-)

Description Similar to MLO12: MLO-like protein 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39200`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At1g61560`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At1g11310`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At5g65970`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At3g45290`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0486300`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010269 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009620 response to fungus Biological Process

GO:0010150 leaf senescence Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G11310

ath:AT1G61560

ath:AT2G39200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.807

Rank 1 · TkA03G516310 · TK1151

Endoplasmic reticulum0.124

Rank 2 · TkA03G516310 · TK1151

Cytoplasm0.084

Rank 3 · TkA03G516310 · TK1151

Lysosome / Vacuole0.065

Rank 4 · TkA03G516310 · TK1151

Golgi apparatus0.043

Rank 5 · TkA03G516310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03094Mlo6-103 aa

PF28791TNFR_grnd_CRD10-49 aa

PF03094Mlo102-445 aa

PF28791TNFR_grnd_CRD117-163 aa

PF13391HNH_2406-459 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G516310	`PF03094`	Mlo	6	103	4.3e-163	543.9
TkA03G516310	`PF28791`	TNFR_grnd_CRD	10	49	0.52	11.3
TkA03G516310	`PF03094`	Mlo	102	445	4.3e-163	543.9
TkA03G516310	`PF28791`	TNFR_grnd_CRD	117	163	0.52	11.3
TkA03G516310	`PF13391`	HNH_2	406	459	0.2	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80961`	Arabidopsis thaliana	sp\|O80961\|MLO12_ARATH MLO-like protein 12	46.300%	Swiss-Prot	Medium
`Q94KB7`	Arabidopsis thaliana	sp\|Q94KB7\|MLO6_ARATH MLO-like protein 6	44.700%	Swiss-Prot	Medium
`Q9SXB6`	Arabidopsis thaliana	sp\|Q9SXB6\|MLO2_ARATH MLO-like protein 2	44.500%	Swiss-Prot	Medium
`Q9FKY5`	Arabidopsis thaliana	sp\|Q9FKY5\|MLO10_ARATH MLO-like protein 10	43.300%	Swiss-Prot	Medium
`Q94KB9`	Arabidopsis thaliana	sp\|Q94KB9\|MLO3_ARATH MLO-like protein 3	34.800%	Swiss-Prot	Medium
`Q0DC45`	Oryza sativa subsp. japonica	sp\|Q0DC45\|MLOH1_ORYSJ MLO protein homolog 1	42.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card