TkA03G512900 | RubberDandelionOmics

Gene overview

TkA03G512900

Reference: TK1151 Chr: Chr03 Coordinates: 128672078-128675990 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

716 bp · TkA03G512900|TK1151|cDNA

AATGTGACATGCCATCTTCCCTACCTCTACAAATACCCCACTCATTCATTAATCACGGGCTTCTAAACTCTTTTCTAAATTCACTCGCCGGCAAATCACTCTCCTCAAATCACCATGGCAACTGATCATCCATCAGAAGCTTCAACAACTAGCCGGAGATTAACACCGGCATCACCCAAAACTAAACTCCCACAGCCGTTTTTGTCAAAGACTTACGATTTGTTGGAGGAAGAAGAAGAGGAAAGCAGGCGGATTGTGTC...

CDS

Download CDS FASTA

588 bp · TkA03G512900|TK1151|CDS

ATGGCAACTGATCATCCATCAGAAGCTTCAACAACTAGCCGGAGATTAACACCGGCATCACCCAAAACTAAACTCCCACAGCCGTTTTTGTCAAAGACTTACGATTTGTTGGAGGAAGAAGAAGAGGAAAGCAGGCGGATTGTGTCATGGAACACCGAGGGGAATGGTTTTGTGGTGTGGTCTCCGGCGGAATTCTCAGAGCAGATGTTGCCACGTTATTTTAAACATAATAATTTCTCAAGCTTCATTCGCCAACTCAA...

Protein

Download Protein FASTA

195 aa · TkA03G512900|TK1151|PROTEIN

MATDHPSEASTTSRRLTPASPKTKLPQPFLSKTYDLLEEEEEESRRIVSWNTEGNGFVVWSPAEFSEQMLPRYFKHNNFSSFIRQLNTYGFKKTASKRWEFQHEKFQKGCKHLLMEMSRKKCEPSVFPTYLKPSTNNQTPSSSSSIEEESMVLLMEENKNLKQEKMELEMQIQHLKSLETKLLDCVSHYMGNNDQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G512900`
TK1151 ID	TkA03G512900
OH-1004 ID	LXL04_010229
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 43.820 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G512900

Location Chr03:128672078-128675990 (-)

Description Similar to HSFB2A: Heat stress transcription factor B-2a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17750`	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release
`At4g36990`	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release
`At5g62020`	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release
`At4g11660`	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0366800`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release
`Os08g0546800`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release
`Os09g0526600`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010229 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G32330

ath:AT4G17750

ath:AT5G62020

dosa:Os02g0527300

dosa:Os04g0568700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.956

Rank 1 · TkA03G512900 · TK1151

Cytoplasm0.141

Rank 2 · TkA03G512900 · TK1151

Cell membrane0.017

Rank 3 · TkA03G512900 · TK1151

Mitochondrion0.015

Rank 4 · TkA03G512900 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA03G512900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00447HSF_DNA-bind29-120 aa

PF11358DUF3158151-189 aa

PF00447HSF_DNA-bind159-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G512900	`PF00447`	HSF_DNA-bind	29	120	1.3e-28	100.2
TkA03G512900	`PF11358`	DUF3158	151	189	0.14	12.5
TkA03G512900	`PF00447`	HSF_DNA-bind	159	165	1.3e-28	100.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P41151`	Arabidopsis thaliana	sp\|P41151\|HFA1A_ARATH Heat stress transcription factor A-1a	59.800%	Swiss-Prot	Low
`Q96320`	Arabidopsis thaliana	sp\|Q96320\|HSFB1_ARATH Heat stress transcription factor B-1	55.700%	Swiss-Prot	Low
`Q9SCW4`	Arabidopsis thaliana	sp\|Q9SCW4\|HFB2A_ARATH Heat stress transcription factor B-2a	51.500%	Swiss-Prot	Low
`Q9T0D3`	Arabidopsis thaliana	sp\|Q9T0D3\|HFB2B_ARATH Heat stress transcription factor B-2b	58.500%	Swiss-Prot	Medium
`Q10KX8`	Oryza sativa subsp. japonica	sp\|Q10KX8\|HFB4D_ORYSJ Heat stress transcription factor B-4d	54.600%	Swiss-Prot	Medium
`Q6Z9C8`	Oryza sativa subsp. japonica	sp\|Q6Z9C8\|HFB2B_ORYSJ Heat stress transcription factor B-2b	53.000%	Swiss-Prot	Medium
`Q652B0`	Oryza sativa subsp. japonica	sp\|Q652B0\|HFB2C_ORYSJ Heat stress transcription factor B-2c	61.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card