TkA03G509430 | RubberDandelionOmics

Gene overview

TkA03G509430

Reference: TK1151 Chr: Chr03 Coordinates: 127753032-127753801 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

699 bp · TkA03G509430|TK1151|cDNA

ATGGAGGAAGACCAGGCTCTCAAGAAACAAAAATATTATTGGGGAAATACCCCAGATGAAGAAGAATACCACAAACTCCATAGCATCAAGTCCACTACCTCTTTCTTTAAATCTCCAAGAGGCTTATCTTTATTCACCAGATCATGGCTTCCCTTCACCCCACCTCGTGGAATCATCTGTATGGTCCACGGATACGGCAACGACATCAGCTGGACCTTCCAGGCCACTGCGATCTTCCTCGCCGCCAACGGGTATGCCTG...

CDS

Download CDS FASTA

699 bp · TkA03G509430|TK1151|CDS

ATGGAGGAAGACCAGGCTCTCAAGAAACAAAAATATTATTGGGGAAATACCCCAGATGAAGAAGAATACCACAAACTCCATAGCATCAAGTCCACTACCTCTTTCTTTAAATCTCCAAGAGGCTTATCTTTATTCACCAGATCATGGCTTCCCTTCACCCCACCTCGTGGAATCATCTGTATGGTCCACGGATACGGCAACGACATCAGCTGGACCTTCCAGGCCACTGCGATCTTCCTCGCCGCCAACGGGTATGCCTG...

Protein

Download Protein FASTA

232 aa · TkA03G509430|TK1151|PROTEIN

MEEDQALKKQKYYWGNTPDEEEYHKLHSIKSTTSFFKSPRGLSLFTRSWLPFTPPRGIICMVHGYGNDISWTFQATAIFLAANGYACFALDMEGHGRSEGLKAFVPNVDDVVADYLAFFTPIVADYPNLPKFLFGESMGGAICLLIECTRPKFFDGAILIAPMCKISDKVRPRWPIPEVLISGKANHRRYESDEIHRKTEIGDSGGAVASDGLFKQPIKQCGYTIHRVTWKR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G509430`
TK1151 ID	TkA03G509430
OH-1004 ID	LXL04_010187
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 78.017 / OH-1004 57.827 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G509430

Location Chr03:127753032-127753801 (-)

Description Similar to CSE: Caffeoylshikimate esterase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52760`	Esterase involved in the biosynthesis of lignin.	Acyl-CoA-binding protein 2 binds lysophospholipase 2 and lysoPC to promote tolerance to cadmium-induced oxidative stress in transgenic Arabidopsis.2010 · DOI: 10.1111/j.1365-313x.2010.04209.x A bifunctional enzyme that has both monoacylglycerol acyltransferase and acyl hydrolase activities.2012 · DOI: 10.1104/pp.112.202135

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010187 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0009966 regulation of signal transduction Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0019369 arachidonate metabolic process Biological Process

GO:0019433 triglyceride catabolic process Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0045471 response to ethanol Biological Process

GO:0045907 positive regulation of vasoconstriction Biological Process

KEGG gene cross-reference

ath:AT1G52760

hsa:11343

mmu:23945

msg:MSMEI_0213

msm:MSMEG_0220

rno:29254

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.344

Rank 1 · TkA03G509430 · TK1151

Endoplasmic reticulum0.172

Rank 2 · TkA03G509430 · TK1151

Nucleus0.171

Rank 3 · TkA03G509430 · TK1151

Mitochondrion0.162

Rank 4 · TkA03G509430 · TK1151

Peroxisome0.149

Rank 5 · TkA03G509430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00326Peptidase_S94-35 aa

PF02129Peptidase_S1544-113 aa

PF12146Hydrolase_454-173 aa

PF11144DUF292056-81 aa

PF00561Abhydrolase_158-163 aa

PF12697Abhydrolase_661-191 aa

PF00326Peptidase_S971-164 aa

PF11144DUF2920128-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G509430	`PF00326`	Peptidase_S9	4	35	0.054	13.7
TkA03G509430	`PF02129`	Peptidase_S15	44	113	0.063	13.7
TkA03G509430	`PF12146`	Hydrolase_4	54	173	2.2e-34	119.5
TkA03G509430	`PF11144`	DUF2920	56	81	0.1	12.5
TkA03G509430	`PF00561`	Abhydrolase_1	58	163	1.6e-11	45.1
TkA03G509430	`PF12697`	Abhydrolase_6	61	191	1.3e-10	43.0
TkA03G509430	`PF00326`	Peptidase_S9	71	164	0.054	13.7
TkA03G509430	`PF11144`	DUF2920	128	158	0.1	12.5
TkA03G509430	`PF00756`	Esterase	129	171	0.0036	17.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C942`	Arabidopsis thaliana	sp\|Q9C942\|CSE_ARATH Caffeoylshikimate esterase	40.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card