TkA03G508450 | RubberDandelionOmics

Gene overview

TkA03G508450

Reference: TK1151 Chr: Chr03 Coordinates: 127453935-127455326 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1250 bp · TkA03G508450|TK1151|cDNA

ACAGATTGGAGCGTACAAGCAACCGTGAGCTGGATATTATCCGAAGCATTCGGACCCGAAAACGTATCAATCGTTGCAGAAGAAGACATCGAAGCCCTCTCCAAACCAACCGCCGCCAACCTCCTCTCCTCCATAGTAACAACCGTCAACAACTCCCTATCCACCGCCGCCACTTTCAACATCCAACCACCACCCACACCTCTCAACCCCACCCAAGTCCTCGAATCCATTAGCCGCTGCAACTCAACTGGCGGTCCTAC...

CDS

Download CDS FASTA

963 bp · TkA03G508450|TK1151|CDS

ACAGATTGGAGCGTACAAGCAACCGTGAGCTGGATATTATCCGAAGCATTCGGACCCGAAAACGTATCAATCGTTGCAGAAGAAGACATCGAAGCCCTCTCCAAACCAACCGCCGCCAACCTCCTCTCCTCCATAGTAACAACCGTCAACAACTCCCTATCCACCGCCGCCACTTTCAACATCCAACCACCACCCACACCTCTCAACCCCACCCAAGTCCTCGAATCCATTAGCCGCTGCAACTCAACTGGCGGTCCTAC...

Protein

Download Protein FASTA

320 aa · TkA03G508450|TK1151|PROTEIN

TDWSVQATVSWILSEAFGPENVSIVAEEDIEALSKPTAANLLSSIVTTVNNSLSTAATFNIQPPPTPLNPTQVLESISRCNSTGGPTGRFWVLDPVDGTLGFVRGDQYAIALALIENGQVVLGVLGCPNYPVNKEWLNYQNGVGSWDGKGCVIYAEKGSKKAWMQPLVNGDEGFVWPNSARRVTVSSIDNPVLATFCEPVEKANSSHSFTQGLAHSVGLRNEPLRVYSMVKYAAIARGDAEIFMKFARAGYKEKIWDHAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G508450`
TK1151 ID	TkA03G508450
OH-1004 ID	LXL04_010163
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.500
Protein coverage (%)	TK1151 99.688 / OH-1004 84.010 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G508450

Location Chr03:127453935-127455326 (+)

Description Similar to AHL: PAP-specific phosphatase HAL2-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54390`	Phosphatase that converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'-phosphoadenosine 5'-phosphate (3'-PAP) to AMP.	No verified direct reference in this release
`At5g09290`	Phosphatase that converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'-phosphate (PAP) to AMP.	No verified direct reference in this release
`At5g63980`	Phosphatase that converts adenosine 3'-phosphate 5'- phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')- phosphoadenosine 5'-phosphate (PAP) to AMP.	FIERY1 encoding an inositol polyphosphate 1-phosphatase is a negative regulator of abscisic acid and stress signaling in Arabidopsis.2001 · DOI: 10.1101/gad.891901 Arabidopsis FIERY1, XRN2, and XRN3 are endogenous RNA silencing suppressors.2007 · DOI: 10.1105/tpc.107.055319 The SAL1 gene of Arabidopsis, encoding an enzyme with 3'(2'),5'-bisphosphate nucleotidase and inositol polyphosphate 1-phosphatase activities, increases salt tolerance in yeast.1996 · DOI: 10.1105/tpc.8.3.529

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: P0C5A3`	Phosphatase that converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'-phosphate (PAP) to AMP.	No verified direct reference in this release
`Os12g0183300`	Phosphatase that converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'-phosphate (PAP) to AMP.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010163 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000103 sulfate assimilation Biological Process

GO:0006401 RNA catabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009968 negative regulation of signal transduction Biological Process

GO:0010587 miRNA catabolic process Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT5G09290

ath:AT5G54390

ath:AT5G63980

dosa:Os12g0183300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.781

Rank 1 · TkA03G508450 · TK1151

Nucleus0.441

Rank 2 · TkA03G508450 · TK1151

Peroxisome0.089

Rank 3 · TkA03G508450 · TK1151

Mitochondrion0.047

Rank 4 · TkA03G508450 · TK1151

Lysosome / Vacuole0.042

Rank 5 · TkA03G508450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00459Inositol_P5-314 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G508450	`PF00459`	Inositol_P	5	314	4e-42	145.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38945`	Arabidopsis thaliana	sp\|Q38945\|DPNPH_ARATH 3',5'-bisphosphate nucleotidase AHL	65.900%	Swiss-Prot	High
`Q84VY5`	Arabidopsis thaliana	sp\|Q84VY5\|DPNP4_ARATH Probable 3'(2'),5'-bisphosphate nucleotidase 4	43.100%	Swiss-Prot	Medium
`Q42546`	Arabidopsis thaliana	sp\|Q42546\|DPNP1_ARATH 3'(2'),5'-bisphosphate nucleotidase 1	42.900%	Swiss-Prot	Medium
`P0C5A3`	Oryza sativa	sp\|P0C5A3\|DPNP_ORYSA 3'(2'),5'-bisphosphate nucleotidase	43.700%	Swiss-Prot	Medium
`Q2QWT4`	Oryza sativa subsp. japonica	sp\|Q2QWT4\|DPNP_ORYSJ 3'(2'),5'-bisphosphate nucleotidase	43.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card