TkA03G508180 | RubberDandelionOmics

Gene overview

TkA03G508180

Reference: TK1151 Chr: Chr03 Coordinates: 127374411-127379819 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1769 bp · TkA03G508180|TK1151|cDNA

ATTTTAATGATAGAGGATAAAAATATATTAGAAAGAAGAGGCCTGCATATCCACGCAAGCCCAAAAAGGCTCCAAATAGACCAAGGAATCTCTCGTTCTCTTACGCGCAGTTTCCTAAAACCTCCCTTCAACAAATTCTTTCTTTCTTTTCTTCTTCAATCTACATAGCCACACAACTGATTCTTCAACATGAATCAGAAAGCGCGGGTTAGCAACGAGCTTCAAGAAAAACACCGTAAGATACTCGAGGGATTACTTAA...

CDS

Download CDS FASTA

1209 bp · TkA03G508180|TK1151|CDS

ATGAATCAGAAAGCGCGGGTTAGCAACGAGCTTCAAGAAAAACACCGTAAGATACTCGAGGGATTACTTAAATTACCAGAGAATCGGGAATGTGCAGAATGCAAAAGCAAGGGTCCAAGATGGGCTAGTGTAAATCTTGGGATATTTATATGTCTACAATGTTCTGGGGTTCATAGAAGTCTTGGAGTACACATATCAAAGGTGAGATCTGCTACACTTGATACATGGCTACCAGATCAGATTGCATTTATACAAACTAT...

Protein

Download Protein FASTA

402 aa · TkA03G508180|TK1151|PROTEIN

MNQKARVSNELQEKHRKILEGLLKLPENRECAECKSKGPRWASVNLGIFICLQCSGVHRSLGVHISKVRSATLDTWLPDQIAFIQTMGNKKSNSFWEAELPPKYDRVGIENFIRAKYVEKRWISRQQKVETHLSIIKKENVPLHKPGPTIYTSTKGIVLLPEPKQTPQLYNLNKTAPPIPSNQQIIIRPKETEPELKPEESKAIVIVSDQKINDYQATDLFDMVNVTQNGSKPSSSNAGPHARSETLQLGEGNNDKKISN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G508180`
TK1151 ID	TkA03G508180
OH-1004 ID	LXL04_010154
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G508180

Location Chr03:127374411-127379819 (-)

Description Similar to AGD5: ADP-ribosylation factor GTPase-activating protein AGD5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54310`	GTPase-activating protein (GAP) for ADP ribosylation factor (ARF).	AGD5 is a GTPase-activating protein at the trans-Golgi network.2010 · DOI: 10.1111/j.1365-313x.2010.04369.x
`At3g17660`	GTPase-activating protein (GAP) for ADP ribosylation factor (ARF).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010154 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010227 floral organ abscission Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0030308 negative regulation of cell growth Biological Process

GO:0035652 clathrin-coated vesicle cargo loading Biological Process

GO:0050829 defense response to Gram-negative bacterium Biological Process

GO:0060866 leaf abscission Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

KEGG gene cross-reference

ath:AT3G17660

ath:AT5G54310

bta:514465

hsa:64744

mmu:69780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.632

Rank 1 · TkA03G508180 · TK1151

Golgi apparatus0.290

Rank 2 · TkA03G508180 · TK1151

Cell membrane0.132

Rank 3 · TkA03G508180 · TK1151

Nucleus0.113

Rank 4 · TkA03G508180 · TK1151

Endoplasmic reticulum0.082

Rank 5 · TkA03G508180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01412ArfGap17-125 aa

PF03766Remorin_N192-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G508180	`PF01412`	ArfGap	17	125	3.8e-41	140.6
TkA03G508180	`PF03766`	Remorin_N	192	208	0.06	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL69`	Arabidopsis thaliana	sp\|Q9FL69\|AGD5_ARATH ADP-ribosylation factor GTPase-activating protein AGD5	45.200%	Swiss-Prot	Medium
`Q0WQQ1`	Arabidopsis thaliana	sp\|Q0WQQ1\|AGD15_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD15	70.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card