TkA03G500910 | RubberDandelionOmics

Gene overview

TkA03G500910

Reference: TK1151 Chr: Chr03 Coordinates: 125753078-125755865 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1476 bp · TkA03G500910|TK1151|cDNA

GTCCACCATTCTCGGCTCAATCACCATTCACCAGTCAACGACCGCCACTGTTGTTAGAAGTTTTATTCCCGCCATGAATCTCCTTAATTGCCCAAGGATTCAATACCCTTCAACTAAATTACTACAACCTTACATTCGATTCAATGTACTCTCAACTTCGTCGTCATTGCCTCTCCGACGATGCAGCGTGAGATCGAGTCTTCCATCTCCGGCTCAGAATGCTAAGTATAACAGAGAACTACGAGCTGCTGTGGATGCGG...

CDS

Download CDS FASTA

1218 bp · TkA03G500910|TK1151|CDS

ATGAATCTCCTTAATTGCCCAAGGATTCAATACCCTTCAACTAAATTACTACAACCTTACATTCGATTCAATGTACTCTCAACTTCGTCGTCATTGCCTCTCCGACGATGCAGCGTGAGATCGAGTCTTCCATCTCCGGCTCAGAATGCTAAGTATAACAGAGAACTACGAGCTGCTGTGGATGCGGTCGAGCGGGCTTGCCGTCTATGTGTTGACGTGAAACGATCTTTGTTCACAAGTGAAGGAAAAATTCTTGAAAA...

Protein

Download Protein FASTA

405 aa · TkA03G500910|TK1151|PROTEIN

MNLLNCPRIQYPSTKLLQPYIRFNVLSTSSSLPLRRCSVRSSLPSPAQNAKYNRELRAAVDAVERACRLCVDVKRSLFTSEGKILEKNDQTPVTIADYGVQALISLELGKLFPSIPLVAEEDSAFLRSNNLVDSVVNVVTDKSSSKDKQLTETEVLEAIDRGGKFGPNPATYWVLDPIDGTRGFLKGNDALYVVGLALVVEGEIVLGVMGCPNWKENRSNSPDWENDKSTLGSGTIMVAHVGCGTWSKELYDPLKWYRCL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G500910`
TK1151 ID	TkA03G500910
OH-1004 ID	LXL04_010163
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	32.900
Protein coverage (%)	TK1151 85.679 / OH-1004 93.655 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G500910

Location Chr03:125753078-125755865 (-)

Description Similar to AHL: PAP-specific phosphatase HAL2-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g05090`	Phosphatase that converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'-phosphate (PAP) to AMP.	No verified direct reference in this release
`At5g64000`	Phosphatase that converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'-phosphoadenosine 5'-phosphate (3'-PAP) to AMP.	The Arabidopsis HAL2-like gene family includes a novel sodium-sensitive phosphatase.1999 · DOI: 10.1046/j.1365-313x.1999.00385.x
`At5g54390`	Phosphatase that converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'-phosphoadenosine 5'-phosphate (3'-PAP) to AMP.	No verified direct reference in this release
`At5g09290`	Phosphatase that converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'-phosphate (PAP) to AMP.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010163 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000103 sulfate assimilation Biological Process

GO:0006401 RNA catabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009968 negative regulation of signal transduction Biological Process

GO:0010587 miRNA catabolic process Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT5G09290

ath:AT5G54390

ath:AT5G63980

dosa:Os12g0183300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.915

Rank 1 · TkA03G500910 · TK1151

Cytoplasm0.079

Rank 2 · TkA03G500910 · TK1151

Mitochondrion0.076

Rank 3 · TkA03G500910 · TK1151

Nucleus0.049

Rank 4 · TkA03G500910 · TK1151

Peroxisome0.048

Rank 5 · TkA03G500910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00459Inositol_P72-394 aa

PF09057Smac_DIABLO96-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G500910	`PF00459`	Inositol_P	72	394	2.1e-32	113.4
TkA03G500910	`PF09057`	Smac_DIABLO	96	151	0.12	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0Y6`	Arabidopsis thaliana	sp\|Q9M0Y6\|DPNPM_ARATH Putative 3'(2'),5'-bisphosphate nucleotidase, mitochondrial	61.200%	Swiss-Prot	High
`O49623`	Arabidopsis thaliana	sp\|O49623\|DPNP2_ARATH 3',5'-bisphosphate nucleotidase 2	34.400%	Swiss-Prot	Medium
`Q38945`	Arabidopsis thaliana	sp\|Q38945\|DPNPH_ARATH 3',5'-bisphosphate nucleotidase AHL	33.600%	Swiss-Prot	Medium
`Q84VY5`	Arabidopsis thaliana	sp\|Q84VY5\|DPNP4_ARATH Probable 3'(2'),5'-bisphosphate nucleotidase 4	33.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card