TkA03G498630 | RubberDandelionOmics

Gene overview

TkA03G498630

Reference: TK1151 Chr: Chr03 Coordinates: 125099806-125100327 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

408 bp · TkA03G498630|TK1151|cDNA

ATGCGCGGCCAATTCTCAGTAAAATCAGATGTATTTAGCTTCGGGGTTTTAGTGTTGGAAATGGTAACAGGACAAAAGAACCAAAGTTTTCAAAATGGAGAGAACGGCGAGTACCTTCTTAGCTATACATGGAAAAGTTGGCGAAATGGGAACGTGACAAACATTATAGATACAACATTGATGAGTACCGGATCTGGTTCATTGCGCGATATGACTAGAAGTGTCCACATTGGGTTATTATGCGTTCAAGAAACTGCTGA...

CDS

Download CDS FASTA

408 bp · TkA03G498630|TK1151|CDS

ATGCGCGGCCAATTCTCAGTAAAATCAGATGTATTTAGCTTCGGGGTTTTAGTGTTGGAAATGGTAACAGGACAAAAGAACCAAAGTTTTCAAAATGGAGAGAACGGCGAGTACCTTCTTAGCTATACATGGAAAAGTTGGCGAAATGGGAACGTGACAAACATTATAGATACAACATTGATGAGTACCGGATCTGGTTCATTGCGCGATATGACTAGAAGTGTCCACATTGGGTTATTATGCGTTCAAGAAACTGCTGA...

Protein

Download Protein FASTA

135 aa · TkA03G498630|TK1151|PROTEIN

MRGQFSVKSDVFSFGVLVLEMVTGQKNQSFQNGENGEYLLSYTWKSWRNGNVTNIIDTTLMSTGSGSLRDMTRSVHIGLLCVQETADDRPTMAAVLLMLNSFSVTLPVPSEPALFSRTTIDPQMTRLQECSSSPI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G498630`
TK1151 ID	TkA03G498630
OH-1004 ID	LXL04_027138
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	63.900
Protein coverage (%)	TK1151 98.519 / OH-1004 19.214 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G498630

Location Chr03:125099806-125100327 (+)

Description Similar to CRK10: Cysteine-rich receptor-like protein kinase 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00970`	Cysteine-rich receptor-like protein kinase 41.	No verified direct reference in this release
`At4g21410`	Cysteine-rich receptor-like protein kinase 29.	No verified direct reference in this release
`At4g00960`	Cysteine-rich receptor-like protein kinase 44.	No verified direct reference in this release
`At4g38830`	Cysteine-rich receptor-like protein kinase 26.	No verified direct reference in this release
`At4g21400`	Cysteine-rich receptor-like protein kinase 28.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027138 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G05200

ath:AT4G21410

ath:AT4G23180

ath:AT4G23230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.563

Rank 1 · TkA03G498630 · TK1151

Cytoplasm0.342

Rank 2 · TkA03G498630 · TK1151

Nucleus0.209

Rank 3 · TkA03G498630 · TK1151

Endoplasmic reticulum0.045

Rank 4 · TkA03G498630 · TK1151

Golgi apparatus0.039

Rank 5 · TkA03G498630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr3-96 aa

PF00069Pkinase4-35 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G498630	`PF07714`	PK_Tyr_Ser-Thr	3	96	4.3e-06	27.0
TkA03G498630	`PF00069`	Pkinase	4	35	0.015	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23081`	Arabidopsis thaliana	sp\|O23081\|CRK41_ARATH Cysteine-rich receptor-like protein kinase 41	56.000%	Swiss-Prot	High
`Q8S9L6`	Arabidopsis thaliana	sp\|Q8S9L6\|CRK29_ARATH Cysteine-rich receptor-like protein kinase 29	53.200%	Swiss-Prot	High
`O23082`	Arabidopsis thaliana	sp\|O23082\|CRK44_ARATH Cysteine-rich receptor-like protein kinase 44	53.400%	Swiss-Prot	High
`Q9T0J1`	Arabidopsis thaliana	sp\|Q9T0J1\|CRK26_ARATH Cysteine-rich receptor-like protein kinase 26	47.400%	Swiss-Prot	Medium
`O65405`	Arabidopsis thaliana	sp\|O65405\|CRK28_ARATH Cysteine-rich receptor-like protein kinase 28	50.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card