TkA03G498460 | RubberDandelionOmics

Gene overview

TkA03G498460

Reference: TK1151 Chr: Chr03 Coordinates: 125055409-125062147 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2458 bp · TkA03G498460|TK1151|cDNA

ATTAACTTAAGTACATAATAACAAACAAAATTGCAATCCGACTCTATTAGTATTAAAGACCTGACCAAAACCAAAAAATAAGGCAAACTAAGGCAATCGAATGATATCGAAAAGAAGACCAAGACCTATAGGTCTCCCAATAAACCGTTTAAATTCCCTGCCACTTCGTCCTCCACAAGACCACAACGGAACATGTTCATACTCGCCGGAAAATTCTTCTTATCGTTATTTTCTATTTTCATGTATTTAATCAATACCAT...

CDS

Download CDS FASTA

2073 bp · TkA03G498460|TK1151|CDS

ATGTTCATACTCGCCGGAAAATTCTTCTTATCGTTATTTTCTATTTTCATGTATTTAATCAATACCATCACCTTAGCTCAACCCGACTTCATTTATTATCGCTGCGAAAACGCAGCTAATTACACCAAAAACAGTACGTACCAAAGAAATCTTGAAACCTCCCTCTCCGCCCTCCCGAACACCAACTCCGGCTTTGGTTTCTACAACCTCTCCACCGGCAATGGAAACGACAGAGTCAACTCCATGGCCCTTTGTCGGGG...

Protein

Download Protein FASTA

690 aa · TkA03G498460|TK1151|PROTEIN

MFILAGKFFLSLFSIFMYLINTITLAQPDFIYYRCENAANYTKNSTYQRNLETSLSALPNTNSGFGFYNLSTGNGNDRVNSMALCRGDVDSNSCRSCLSDSIVKLPQICPVQREAIGYYDNCLLQYSDNIISGYNQQGTNENLVNPQNATDRDRFTRSLMSLLNELGREAAAGGPLRRFATGNTSGPDFTTIYGLAQCTPDLSEQECSDCLDDSVNQFAILYSGKIAGRSLLPMCNFRYEIFRFFNGSTMVIPSPPSPPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G498460`
TK1151 ID	TkA03G498460
OH-1004 ID	LXL04_027138
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	55.800
Protein coverage (%)	TK1151 98.551 / OH-1004 99.127 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G498460

Location Chr03:125055409-125062147 (+)

Description Similar to CRK10: Cysteine-rich receptor-like protein kinase 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23160`	Cysteine-rich receptor-like protein kinase 8.	No verified direct reference in this release
`At4g23150`	Cysteine-rich receptor-like protein kinase 7.	No verified direct reference in this release
`At4g38830`	Cysteine-rich receptor-like protein kinase 26.	No verified direct reference in this release
`At4g23230`	Cysteine-rich receptor-like protein kinase 15.	No verified direct reference in this release
`At4g05200`	Cysteine-rich receptor-like protein kinase 25.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027138 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G05200

ath:AT4G21410

ath:AT4G23180

ath:AT4G23230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.886

Rank 1 · TkA03G498460 · TK1151

Endoplasmic reticulum0.071

Rank 2 · TkA03G498460 · TK1151

Cytoplasm0.066

Rank 3 · TkA03G498460 · TK1151

Nucleus0.038

Rank 4 · TkA03G498460 · TK1151

Lysosome / Vacuole0.023

Rank 5 · TkA03G498460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01657Stress-antifung35-128 aa

PF01657Stress-antifung147-240 aa

PF15345TMEM51272-310 aa

PF15102TMEM154273-329 aa

PF10176NEDD4_Bsd2276-309 aa

PF00069Pkinase349-558 aa

PF07714PK_Tyr_Ser-Thr351-616 aa

PF03109ABC1351-377 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G498460	`PF01657`	Stress-antifung	35	128	2.5e-36	125.0
TkA03G498460	`PF01657`	Stress-antifung	147	240	2.5e-36	125.0
TkA03G498460	`PF15345`	TMEM51	272	310	0.17	12.4
TkA03G498460	`PF15102`	TMEM154	273	329	0.15	12.6
TkA03G498460	`PF10176`	NEDD4_Bsd2	276	309	0.17	12.9
TkA03G498460	`PF00069`	Pkinase	349	558	6e-44	151.1
TkA03G498460	`PF07714`	PK_Tyr_Ser-Thr	351	616	6.8e-44	150.8
TkA03G498460	`PF03109`	ABC1	351	377	0.0026	17.7
TkA03G498460	`PF03109`	ABC1	416	499	0.0026	17.7
TkA03G498460	`PF17667`	Pkinase_fungal	454	536	0.053	13.0
TkA03G498460	`PF10176`	NEDD4_Bsd2	647	663	0.17	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65468`	Arabidopsis thaliana	sp\|O65468\|CRK8_ARATH Cysteine-rich receptor-like protein kinase 8	45.600%	Swiss-Prot	Medium
`Q8L7G3`	Arabidopsis thaliana	sp\|Q8L7G3\|CRK7_ARATH Cysteine-rich receptor-like protein kinase 7	44.700%	Swiss-Prot	Medium
`Q9T0J1`	Arabidopsis thaliana	sp\|Q9T0J1\|CRK26_ARATH Cysteine-rich receptor-like protein kinase 26	46.000%	Swiss-Prot	Medium
`Q8W4G6`	Arabidopsis thaliana	sp\|Q8W4G6\|CRK15_ARATH Cysteine-rich receptor-like protein kinase 15	45.900%	Swiss-Prot	Medium
`Q9M0X5`	Arabidopsis thaliana	sp\|Q9M0X5\|CRK25_ARATH Cysteine-rich receptor-like protein kinase 25	41.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card