TkA03G498270 | RubberDandelionOmics

Gene overview

TkA03G498270

Reference: TK1151 Chr: Chr03 Coordinates: 125022252-125025379 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1650 bp · TkA03G498270|TK1151|cDNA

CCGCTCAAAAAGGAATTATCATCATATGAGAGTTTTTTCGCTTTAAATGTTTGGTGTTGAAGTCAATTTCTGCTGCTAACTTGATCTCTCTCCCAAATTGAGATCTATCGGTGTGTTCAGTCTCGAAGTTTTCTGTGAAGAAAATGCCGGTGGAGCTTTGCCGGAGAGTTTCATTGACATTTTCCAATTGTTGTAGTTAGTTCGAAGCTCTGATGGTGCCGACGGAGCTCATTTTTCGAGCATAAGATTATTTCCTAAGT...

CDS

Download CDS FASTA

1203 bp · TkA03G498270|TK1151|CDS

ATGACGTTGTTCAATGTCACTACACGCACCACACTTGTGTTTATCGTCGCTGTACCTAACTACCTTTCCACCGAAGAGTTCATCGCTTTATGTGGCTCTCACGTTGAGTACTTCTCCGATCTCTGTTTCATCAGAAATGATGCGATGGAAGATCGGTATAGCGTGCTTATTAAGCTAGTGAACCAAGCGGCTGCTGATGGATTCTGTTGCAGCTACAAGTCTATAATGGAAAGCGGTTTAACTGAGGTTTGCCACATCTA...

Protein

Download Protein FASTA

400 aa · TkA03G498270|TK1151|PROTEIN

MTLFNVTTRTTLVFIVAVPNYLSTEEFIALCGSHVEYFSDLCFIRNDAMEDRYSVLIKLVNQAAADGFCCSYKSIMESGLTEVCHIYFAQLVEYTDSAEIASIPQPGYTELPTCPVCLVVRYKHPDALLALQDYSVAMASTFLSVPSVSPSATMSVQDKCKMKSGTSFRSAFFGKDKQQPLSMKPKSHGHVTMTVASKASRFDSITMAPPDPILGVSEAFKADTSELKLNLGVGAYRTEELHPYVLKIVRKAENLMLERG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G498270`
TK1151 ID	TkA03G498270
OH-1004 ID	LXL04_010100
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.100
Protein coverage (%)	TK1151 88.250 / OH-1004 86.265 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G498270

Location Chr03:125022252-125025379 (+)

Description Similar to ASP5: Aspartate aminotransferase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31990`	Amino acid aminotransferase important for the metabolism of amino acids and Krebs-cycle related organic acids.	Recombinant expression, purification, and characterization of three isoenzymes of aspartate aminotransferase from Arabidopsis thaliana.1998 · DOI: 10.1006/prep.1997.0845

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010100 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006103 2-oxoglutarate metabolic process Biological Process

GO:0006457 protein folding Biological Process

GO:0006520 amino acid metabolic process Biological Process

GO:0006531 aspartate metabolic process Biological Process

GO:0006533 L-aspartate catabolic process Biological Process

GO:0006536 glutamate metabolic process Biological Process

GO:0006869 lipid transport Biological Process

GO:0009409 response to cold Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009501 amyloplast Cellular Component

KEGG gene cross-reference

ath:AT4G31990

ocu:100348732

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.461

Rank 1 · TkA03G498270 · TK1151

Nucleus0.422

Rank 2 · TkA03G498270 · TK1151

Mitochondrion0.103

Rank 3 · TkA03G498270 · TK1151

Endoplasmic reticulum0.079

Rank 4 · TkA03G498270 · TK1151

Cell membrane0.078

Rank 5 · TkA03G498270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07576BRAP27-101 aa

PF00155Aminotran_1_213-53 aa

PF00155Aminotran_1_2228-295 aa

PF00155Aminotran_1_2297-337 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G498270	`PF07576`	BRAP2	7	101	5.8e-23	81.7
TkA03G498270	`PF00155`	Aminotran_1_2	13	53	2.4e-13	50.8
TkA03G498270	`PF00155`	Aminotran_1_2	228	295	2.4e-13	50.8
TkA03G498270	`PF00155`	Aminotran_1_2	297	337	2.4e-13	50.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46248`	Arabidopsis thaliana	sp\|P46248\|AAT5_ARATH Aspartate aminotransferase, chloroplastic	59.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card