TkA03G498140 | RubberDandelionOmics

Gene overview

TkA03G498140

Reference: TK1151 Chr: Chr03 Coordinates: 124984769-124986176 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

870 bp · TkA03G498140|TK1151|cDNA

ATGGTGAAAAAGCTGCTAAAAACCGTACCAAGAAAGTTCCTTCATATCGTCGCCTCCCTCGAGCAAGTGCTCGATTTGAAGACGGTACCTTTCGACGACATCGTAGGGCGTCTGAAAGCATACGAAGAAAGAATCAGAGGAGATGAGGGCGGAGACGAGCAACAGAAGGTGCTGATGGCGAGATCGGGTGGCGACGGCGGCTCGAACGGCGGTGGTGGATCGCGATCGTCCGGAAGTTCATCGGGAGGGATGACGGGATC...

CDS

Download CDS FASTA

870 bp · TkA03G498140|TK1151|CDS

ATGGTGAAAAAGCTGCTAAAAACCGTACCAAGAAAGTTCCTTCATATCGTCGCCTCCCTCGAGCAAGTGCTCGATTTGAAGACGGTACCTTTCGACGACATCGTAGGGCGTCTGAAAGCATACGAAGAAAGAATCAGAGGAGATGAGGGCGGAGACGAGCAACAGAAGGTGCTGATGGCGAGATCGGGTGGCGACGGCGGCTCGAACGGCGGTGGTGGATCGCGATCGTCCGGAAGTTCATCGGGAGGGATGACGGGATC...

Protein

Download Protein FASTA

289 aa · TkA03G498140|TK1151|PROTEIN

MVKKLLKTVPRKFLHIVASLEQVLDLKTVPFDDIVGRLKAYEERIRGDEGGDEQQKVLMARSGGDGGSNGGGGSRSSGSSSGGMTGSEGTKGKWGRNNPREGFNSDGSVSGSGSWGGSGSNPAQNSNRPNNKKQLNTNKKCNCDCCEKNRRNPKNDRSKIVCYRCDKPGHYASECPERPQKSQDGDFSGGEDNDEAAWKSWRNGNVTNIIDTTLMSTGSGSLRDITRSVHIGLLCVQETADDRPTMAAVVLMLNSFSVTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G498140`
TK1151 ID	TkA03G498140
OH-1004 ID	LXL04_021669
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	63.800
Protein coverage (%)	TK1151 68.512 / OH-1004 27.419 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G498140

Location Chr03:124984769-124986176 (+)

Description Similar to HSFB2A: Heat stress transcription factor B-2a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00970`	Cysteine-rich receptor-like protein kinase 41.	No verified direct reference in this release
`At4g21410`	Cysteine-rich receptor-like protein kinase 29.	No verified direct reference in this release
`At4g00960`	Cysteine-rich receptor-like protein kinase 44.	No verified direct reference in this release
`At4g23280`	Putative cysteine-rich receptor-like protein kinase 20.	No verified direct reference in this release
`At4g23310`	Putative cysteine-rich receptor-like protein kinase 23.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021669 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT4G11660

ath:AT5G62020

dosa:Os08g0546800

dosa:Os09g0526600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.543

Rank 1 · TkA03G498140 · TK1151

Nucleus0.336

Rank 2 · TkA03G498140 · TK1151

Cell membrane0.250

Rank 3 · TkA03G498140 · TK1151

Endoplasmic reticulum0.066

Rank 4 · TkA03G498140 · TK1151

Extracellular0.035

Rank 5 · TkA03G498140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00098zf-CCHC161-177 aa

PF13696zf-CCHC_2161-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G498140	`PF00098`	zf-CCHC	161	177	7.6e-07	29.7
TkA03G498140	`PF13696`	zf-CCHC_2	161	177	0.0015	19.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23081`	Arabidopsis thaliana	sp\|O23081\|CRK41_ARATH Cysteine-rich receptor-like protein kinase 41	58.300%	Swiss-Prot	Low
`Q8S9L6`	Arabidopsis thaliana	sp\|Q8S9L6\|CRK29_ARATH Cysteine-rich receptor-like protein kinase 29	44.000%	Swiss-Prot	Low
`O23082`	Arabidopsis thaliana	sp\|O23082\|CRK44_ARATH Cysteine-rich receptor-like protein kinase 44	52.800%	Swiss-Prot	Low
`O65479`	Arabidopsis thaliana	sp\|O65479\|CRK20_ARATH Putative cysteine-rich receptor-like protein kinase 20	45.300%	Swiss-Prot	Low
`O65482`	Arabidopsis thaliana	sp\|O65482\|CRK23_ARATH Putative cysteine-rich receptor-like protein kinase 23	44.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card