TkA03G493320 | RubberDandelionOmics

Gene overview

TkA03G493320

Reference: TK1151 Chr: Chr03 Coordinates: 123696473-123699926 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

834 bp · TkA03G493320|TK1151|cDNA

ATGGGTGGTCAACTGATTTGGACATGCTTAAAATACATTCCTCACAGGCTAGTAGGAGCGACTCTTATAGCTCCAGCAGATAATTACTGGTGGCCAAGTTTGCCTGCTAACTTATCTAAACAAGCTTTTCCGGAGCTTTTTGTGGAGGATCAATGGAGTCTACGTGTTGCTCACTACCTTCCATCGCTGACTTATCGGTGGAATACTCAGAAGCTTTTTCCTTCTTCTAAAGCTATTGCTCATAGCCCTGATATTCTTTC...

CDS

Download CDS FASTA

834 bp · TkA03G493320|TK1151|CDS

ATGGGTGGTCAACTGATTTGGACATGCTTAAAATACATTCCTCACAGGCTAGTAGGAGCGACTCTTATAGCTCCAGCAGATAATTACTGGTGGCCAAGTTTGCCTGCTAACTTATCTAAACAAGCTTTTCCGGAGCTTTTTGTGGAGGATCAATGGAGTCTACGTGTTGCTCACTACCTTCCATCGCTGACTTATCGGTGGAATACTCAGAAGCTTTTTCCTTCTTCTAAAGCTATTGCTCATAGCCCTGATATTCTTTC...

Protein

Download Protein FASTA

277 aa · TkA03G493320|TK1151|PROTEIN

MGGQLIWTCLKYIPHRLVGATLIAPADNYWWPSLPANLSKQAFPELFVEDQWSLRVAHYLPSLTYRWNTQKLFPSSKAIAHSPDILSSQDVELIPKFTTGRGPIQKIIPSARKELPSGNYPQIGFKSMYGSVSHLKRCPVILLLNIDAGNGLCNGTCLICRSFQPHVIDAEIAVGQHAGKMVFLPRIPLSPSDDDMFPFKLRRKQFLVRLCFAMTINKAQGQTIPNVGVYLPEPVFSHGQLYVALSRGISRGNTKVLVKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G493320`
TK1151 ID	TkA03G493320
OH-1004 ID	LXL04_038087
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.800
Protein coverage (%)	TK1151 100.000 / OH-1004 72.796 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G493320`
Location	Chr03:123696473-123699926 (-)
Description	Similar to pif1: ATP-dependent DNA helicase PIF1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038087` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000723 telomere maintenance Biological Process GO:0006260 DNA replication Biological Process GO:0006270 DNA replication initiation Biological Process GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0009744 response to sucrose Biological Process GO:0033314 mitotic DNA replication checkpoint signaling Biological Process GO:0051276 chromosome organization Biological Process GO:0000808 origin recognition complex Cellular Component GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT4G14700 bba:Bd3546 dosa:Os06g0187000 tbr:Tb10.70.7240 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.324

Rank 1 · TkA03G493320 · TK1151

Nucleus0.176

Rank 2 · TkA03G493320 · TK1151

Mitochondrion0.158

Rank 3 · TkA03G493320 · TK1151

Peroxisome0.148

Rank 4 · TkA03G493320 · TK1151

Plastid0.100

Rank 5 · TkA03G493320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21530Pif1_2B_dom138-159 aa

PF01443Viral_helicase1209-247 aa

PF13538UvrD_C_2211-247 aa

PF02689Herpes_Helicase212-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G493320	`PF21530`	Pif1_2B_dom	138	159	3.5e-05	24.1
TkA03G493320	`PF01443`	Viral_helicase1	209	247	0.14	12.7
TkA03G493320	`PF13538`	UvrD_C_2	211	247	0.0011	19.5
TkA03G493320	`PF02689`	Herpes_Helicase	212	253	0.021	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card