TkA03G491640 | RubberDandelionOmics

Gene overview

TkA03G491640

Reference: TK1151 Chr: Chr03 Coordinates: 123231470-123234273 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2582 bp · TkA03G491640|TK1151|cDNA

AGACTCTGCCTTCTTGTGGTATCCTGATCGTATCCAATTCTTCGTTCGTATGATCTCCGAAGGAAAACCTTAGTTCTCCATGGCAACCAGAAGACACAGTCAAATTAATTCACGAGAAAATTCAGGCCGCCACCGGAATTCCGATGATCGAACAGCGCTTTATTTATCGAGGGCGGCAGCTTCAGTGGGATTATACTTTGGCCGAGTGTAAGATTTACAACGACGCCGGCTTGCATTTGGTTATGTAAAGAGAAACAGGA...

CDS

Download CDS FASTA

795 bp · TkA03G491640|TK1151|CDS

ATGATCTTCATTGAGCTTTTTGAGAAAGTTCAAATGTGTCTTGATAAAATAGAGACTTACTTGGCTATAGAAAAGAGACCATTCATAGGCTGGGAATCATATCTTGCACTCTTGAAACAACTTCGTGGTATTTCCAAACTATATCAAGGTGCAGAAGAATTCTTTTGGGAAAATCTCAAAAAGAACAAGGTTTCAGTCTGCTATCTGATTGTTAACAATGCTAAAAGAGGTGAAGATTACAAATGGATTCTTGGACAGAA...

Protein

Download Protein FASTA

264 aa · TkA03G491640|TK1151|PROTEIN

MIFIELFEKVQMCLDKIETYLAIEKRPFIGWESYLALLKQLRGISKLYQGAEEFFWENLKKNKVSVCYLIVNNAKRGEDYKWILGQKDVIDFESRRHLVLCLLPEMKDEFDELHEMLIDRSHLLAESFAYIGRGDPETLRGGIFMEFKKEEATGPGVLREWFFLVCQEIFNPQNALFIACPNDRRRFFPNPASRVDPLHLEYFNFAGRIIALALMHKVQVGIAFDRAFLPTTIRKKHLTRRHKRCRSIPIQQLQTNPRHG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G491640`
TK1151 ID	TkA03G491640
OH-1004 ID	LXL04_010032
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.700
Protein coverage (%)	TK1151 86.364 / OH-1004 27.273 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G491640

Location Chr03:123231470-123234273 (-)

Description Similar to UPL5: E3 ubiquitin-protein ligase UPL5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12570`	E3 ubiquitin protein ligase that regulates leaf senescence through ubiquitination and subsequent degradation of WRKY53.	A HECT E3 ubiquitin ligase negatively regulates Arabidopsis leaf senescence through degradation of the transcription factor WRKY53.2010 · DOI: 10.1111/j.1365-313x.2010.04233.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010032 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006284 base-excision repair Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006513 protein monoubiquitination Biological Process

GO:0007030 Golgi organization Biological Process

GO:0007249 canonical NF-kappaB signal transduction Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010637 negative regulation of mitochondrial fusion Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031398 positive regulation of protein ubiquitination Biological Process

KEGG gene cross-reference

ath:AT4G12570

hsa:10075

mmu:59026

ncr:NCU08501

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.444

Rank 1 · TkA03G491640 · TK1151

Nucleus0.414

Rank 2 · TkA03G491640 · TK1151

Mitochondrion0.083

Rank 3 · TkA03G491640 · TK1151

Plastid0.065

Rank 4 · TkA03G491640 · TK1151

Cell membrane0.059

Rank 5 · TkA03G491640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00632HECT164-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G491640	`PF00632`	HECT	164	239	2.3e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU29`	Arabidopsis thaliana	sp\|Q9SU29\|UPL5_ARATH E3 ubiquitin-protein ligase UPL5	54.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card