TkA03G489940 | RubberDandelionOmics

Gene overview

TkA03G489940

Reference: TK1151 Chr: Chr03 Coordinates: 122827791-122828843 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1053 bp · TkA03G489940|TK1151|cDNA

ATGGAGGGAGAGGTATACAATTTCGTGGTAAATTGGAGCACAGCTTTGGCATCTCTCCTATTTTCTCATGTTATTGGCAAGTTTATTGCTAAAGGCCCAACTAGATTCTTGGTTCTATTTCCAGTCATATGTCTTTTCCTATGTCTTCCCTTAAATCTCCAAAGTGTGTATTTTGCCGGACCAACTTCTTTCTTCATGTCATGGCTTGGAACCTTCAAGCTCATTCTTTATGCCTTTGGTCAAGGCCCTTTATCCACTAA...

CDS

Download CDS FASTA

1053 bp · TkA03G489940|TK1151|CDS

ATGGAGGGAGAGGTATACAATTTCGTGGTAAATTGGAGCACAGCTTTGGCATCTCTCCTATTTTCTCATGTTATTGGCAAGTTTATTGCTAAAGGCCCAACTAGATTCTTGGTTCTATTTCCAGTCATATGTCTTTTCCTATGTCTTCCCTTAAATCTCCAAAGTGTGTATTTTGCCGGACCAACTTCTTTCTTCATGTCATGGCTTGGAACCTTCAAGCTCATTCTTTATGCCTTTGGTCAAGGCCCTTTATCCACTAA...

Protein

Download Protein FASTA

350 aa · TkA03G489940|TK1151|PROTEIN

MEGEVYNFVVNWSTALASLLFSHVIGKFIAKGPTRFLVLFPVICLFLCLPLNLQSVYFAGPTSFFMSWLGTFKLILYAFGQGPLSTNPPLPLSHFITTACLPIKILRNDETPSHQTTKKSHIDYVPRVLLFIFVTKAYGYKDFLPSLLTLSFLSYYFVFMLIQFLAAIAILVRTILWVELEPQFDEPHHSTSVQNFWGNRWNLMVSDTLRPTVYHPARAIFSHFVPEKWVSVPAVFITFLVSGIMHELILYHLGQSTPTW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G489940`
TK1151 ID	TkA03G489940
OH-1004 ID	LXL04_010026
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	64.300
Protein coverage (%)	TK1151 84.000 / OH-1004 99.664 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G489940

Location Chr03:122827791-122828843 (-)

Description Similar to ASAT1: Acyl-CoA--sterol O-acyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51970`	Involved in the esterification of cycloartenol.	Biosynthesis of phytosterol esters: identification of a sterol o-acyltransferase in Arabidopsis.2007 · DOI: 10.1104/pp.107.106278 Involvement of the phospholipid sterol acyltransferase1 in plant sterol homeostasis and leaf senescence.2010 · DOI: 10.1104/pp.109.145672
`At1g34500`	Catalyzes the final step in the synthesis of long-chain linear esters (waxes).	No verified direct reference in this release
`At5g55360`	Catalyzes the final step in the synthesis of long-chain linear esters (waxes).	No verified direct reference in this release
`At5g55350`	Catalyzes the final step in the synthesis of long-chain linear esters (waxes).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010026 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0016127 sterol catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008374 O-acyltransferase activity Molecular Function

GO:0047196 long-chain-alcohol O-fatty-acyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G34520

ath:AT3G51970

ath:AT5G55350

ath:AT5G55360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.847

Rank 1 · TkA03G489940 · TK1151

Cell membrane0.061

Rank 2 · TkA03G489940 · TK1151

Nucleus0.058

Rank 3 · TkA03G489940 · TK1151

Golgi apparatus0.052

Rank 4 · TkA03G489940 · TK1151

Cytoplasm0.050

Rank 5 · TkA03G489940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13813MBOAT_2181-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G489940	`PF13813`	MBOAT_2	181	267	7.5e-18	65.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SV07`	Arabidopsis thaliana	sp\|Q9SV07\|ASAT1_ARATH Acyl-CoA--sterol O-acyltransferase 1	40.200%	Swiss-Prot	Medium
`Q4PT07`	Arabidopsis thaliana	sp\|Q4PT07\|WAXS9_ARATH Probable long-chain-alcohol O-fatty-acyltransferase 9	38.100%	Swiss-Prot	Medium
`Q9FJ74`	Arabidopsis thaliana	sp\|Q9FJ74\|WAXS3_ARATH Probable long-chain-alcohol O-fatty-acyltransferase 3	39.800%	Swiss-Prot	Medium
`Q9FJ75`	Arabidopsis thaliana	sp\|Q9FJ75\|WAXS4_ARATH Probable long-chain-alcohol O-fatty-acyltransferase 4	38.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card