TkA03G487730 | RubberDandelionOmics

Gene overview

TkA03G487730

Reference: TK1151 Chr: Chr03 Coordinates: 122047279-122050188 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1076 bp · TkA03G487730|TK1151|cDNA

CTTCCACTCACACTACAATTACATCACTCATTCTCCACCCTTCCGTTGCCTGATCGCCCCATTGTTCGCTTTTCTGCTTCGTCGATTTGGACATGGCGGAAAAAGCATCTGGTATAGATTCGCTCGATGAGTTTCTCAACGTCGCAGTTGATGTAGCTAAAAAAGCTGGCGAGGTAATTCGGAAAGCATTTTACCAGACTAAGCATGTGGAGCACAAAGGATCGGTGGATTTGGTCACAGAAACAGACAAATCTTGTGAA...

CDS

Download CDS FASTA

825 bp · TkA03G487730|TK1151|CDS

ATGGCGGAAAAAGCATCTGGTATAGATTCGCTCGATGAGTTTCTCAACGTCGCAGTTGATGTAGCTAAAAAAGCTGGCGAGGTAATTCGGAAAGCATTTTACCAGACTAAGCATGTGGAGCACAAAGGATCGGTGGATTTGGTCACAGAAACAGACAAATCTTGTGAAGATCTCATATTCAATCATCTAAAGCAGCATTTCCCCAGCCACAAGTTCATTGGAGAAGAAACCACTGCTGCCAATGGTGTAACTCAGCTGAC...

Protein

Download Protein FASTA

274 aa · TkA03G487730|TK1151|PROTEIN

MAEKASGIDSLDEFLNVAVDVAKKAGEVIRKAFYQTKHVEHKGSVDLVTETDKSCEDLIFNHLKQHFPSHKFIGEETTAANGVTQLTDEPTWIVDPLDGTTNFVHGFPFVCVSIGLTIRKVPTVGVVYNPIMDELFTAIDGKGAFLNGNPIKVSSQSELVTSLLATEAGTKRDKATLDATTNRINSLLYKVRSIRMGGSCALGLCGVACGRIDLFYELGFGGPWDVAAGAVIVKEAGGLIFDPSGNDFDITAQRIAASNP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G487730`
TK1151 ID	TkA03G487730
OH-1004 ID	LXL04_009982
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G487730

Location Chr03:122047279-122050188 (-)

Description Similar to IMP3: Inositol monophosphatase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02870`	Phosphatase acting on L-galactose 1-phosphate (L-Gal 1-P), D- myoinositol 3-phosphate (D-Ins 3-P) and D-myoinositol 1-phosphate (D- Ins 1-P).	A highly specific L-galactose-1-phosphate phosphatase on the path to ascorbate biosynthesis.2004 · DOI: 10.1073/pnas.0407453101 Arabidopsis thaliana VTC4 encodes L-galactose-1-P phosphatase, a plant ascorbic acid biosynthetic enzyme.2006 · DOI: 10.1074/jbc.m601409200 VTC4 is a bifunctional enzyme that affects myoinositol and ascorbate biosynthesis in plants.2009 · DOI: 10.1104/pp.108.135129

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009982 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006020 inositol metabolic process Biological Process

GO:0006021 inositol biosynthetic process Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0019853 L-ascorbic acid biosynthetic process Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0008934 inositol monophosphate 1-phosphatase activity Molecular Function

GO:0010347 L-galactose-1-phosphate phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT3G02870

sly:544013

sly:544014

sly:544280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.792

Rank 1 · TkA03G487730 · TK1151

Nucleus0.360

Rank 2 · TkA03G487730 · TK1151

Peroxisome0.080

Rank 3 · TkA03G487730 · TK1151

Mitochondrion0.068

Rank 4 · TkA03G487730 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA03G487730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00459Inositol_P11-272 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G487730	`PF00459`	Inositol_P	11	272	1e-83	281.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8S8`	Arabidopsis thaliana	sp\|Q9M8S8\|VTC4_ARATH Inositol-phosphate phosphatase	82.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card